NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003603

3300003603: Archaeal communities from Yellowstone National Park, Wyoming, USA - Perpetual Spouter C (PS_C) MetaG



Overview

Basic Information
IMG/M Taxon OID3300003603 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0067861 | Gp0093347 | Ga0040887
Sample NameArchaeal communities from Yellowstone National Park, Wyoming, USA - Perpetual Spouter C (PS_C) MetaG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size79761076
Sequencing Scaffolds16
Novel Protein Genes17
Associated Families12

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria5
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-11
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Kryptonia → Candidatus Kryptonium → Candidatus Kryptonium thompsoni1
All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis → Thermocrinis ruber1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus2
Not Available3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus → Thermus caldifontis1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSaline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → spring water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008426Metagenome / Metatranscriptome333Y
F023604Metagenome / Metatranscriptome209Y
F028182Metagenome / Metatranscriptome192N
F043237Metagenome / Metatranscriptome156Y
F057399Metagenome / Metatranscriptome136N
F057782Metagenome / Metatranscriptome136Y
F069506Metagenome124N
F075398Metagenome / Metatranscriptome119N
F075803Metagenome / Metatranscriptome118Y
F087246Metagenome / Metatranscriptome110N
F096328Metagenome104Y
F102748Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI26466J51736_1000080All Organisms → cellular organisms → Bacteria48063Open in IMG/M
JGI26466J51736_1000495All Organisms → cellular organisms → Bacteria18397Open in IMG/M
JGI26466J51736_1000525All Organisms → cellular organisms → Bacteria17630Open in IMG/M
JGI26466J51736_1000977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-111876Open in IMG/M
JGI26466J51736_1001905All Organisms → cellular organisms → Bacteria7304Open in IMG/M
JGI26466J51736_1004019All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3590Open in IMG/M
JGI26466J51736_1004131All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Kryptonia → Candidatus Kryptonium → Candidatus Kryptonium thompsoni3489Open in IMG/M
JGI26466J51736_1004656All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis → Thermocrinis ruber3055Open in IMG/M
JGI26466J51736_1005711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus2398Open in IMG/M
JGI26466J51736_1006730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus1974Open in IMG/M
JGI26466J51736_1006746All Organisms → cellular organisms → Bacteria1971Open in IMG/M
JGI26466J51736_1006765Not Available1964Open in IMG/M
JGI26466J51736_1009859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus → Thermus caldifontis1247Open in IMG/M
JGI26466J51736_1013455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium879Open in IMG/M
JGI26466J51736_1017020Not Available695Open in IMG/M
JGI26466J51736_1021766Not Available547Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI26466J51736_1000080JGI26466J51736_100008048F087246MDWEIWMDETYELCKALDAIQHARQVMAFHAQGYRQVATLAGLALERIEAVRGSQNWVQLHETMQEVGALLEAILLQATERAENLQECADGYADADLERR*
JGI26466J51736_1000495JGI26466J51736_100049525F028182MRYNTLVMPKVSISEAARRLDTTEEVIREWIRLGLLDVEPPPAKPRRTRELNLAFQPTSAVPEPKVDLEQLYEVAEREGWLLLSLEAWDAADSEP*
JGI26466J51736_1000525JGI26466J51736_100052514F069506MELEQLTYTEEQIKQAIEEVWQELLQEADAENYSLEEYLEDYRKYWDEPDFPNDIPELIMRTVEKIVGSPLSWYCELVRDPAGFTGEYSFVVVDPKTQKCLTYREHTFDGVNVHRFINVAGTVVNYEDIVRLVTKLLNQIQSALADA*
JGI26466J51736_1000977JGI26466J51736_10009777F023604MAMDISVPKAAVKSRAVEKAXLKGMRPPAGEEDKPWQAYANETNFCKVKIDYISN*
JGI26466J51736_1001629JGI26466J51736_10016298F102748MMNSLRAICCGRYNRAVGFLPKPSVLSKLAVVLLVCTLTLLCRQPTVADSASQHTQDVRVYKIRVDYTATIRYTDARGEVQEKSVQRACEFVFDTPISFEEAMSLIDGAFVTGVSSHNSLTHEVTKACSEQCRGVWCCWLGRNSKEWAWKPDGIWLASLY*
JGI26466J51736_1001905JGI26466J51736_10019058F008426MSGTQYLSPLLQDPAWQALSRQLSVEARIAIFYLDELWKDERFQRDWTRLKEAYFEAQREAIAELRELFRKDFRTLTNAARKRAEALFLRGANEHASCLVRQLKEYVPDLIRDATWSYLFGRACEADREAEDEDSNRRKIYAISTENIYASRDPENFRLTEWELVRGFFSGELGELRLGIYYHDRRDRAHESFVAFSSKTPFFVPNTCAPLPSESKQDYLKRIKRDLEHELKLLAEPCSHRQPLILPRFLNKLKQLGYEFHNPRNAIPAILALAEDYYEKCDAERRNQVSNRSDATLCFYAKVVYQHKVKGLTHWKEIAGEIMPEGEDLEDWTDRVRKALPVAYELLGLPCEQKGENSENHP*
JGI26466J51736_1004019JGI26466J51736_10040191F057782MVLHPPTPYTLSPLLKGGKGRGEEGSYTHVPCLFGALLGTLYHLQSKTF*
JGI26466J51736_1004131JGI26466J51736_10041312F075398MLRRLESGRLTFGVSVGLLGMALMSLGYARVDKAPTFKTDPYPFVENLGQLADPEGRPLRDAYFSFEAPGMRGYVTRWG*
JGI26466J51736_1004656JGI26466J51736_10046561F043237MDLEKTARYIAQLSRHGYKYAVLGELSNYNRELVKRIDLEGFVFYLCRLQTKKEVISYCLQKADKPFKVYCLSSKPLEIPHMPLKLHYDEKTGRLRLLAQKSFINACLNAIEKASEVKYPSPKLYIAQVNKALRQLYSVLAHTYNDKERLRAIKRKVKHWVVEALKSQYGLKPKDAMLDYSRYVLKFSDVLRKKKSASVASATEGGRGRG*
JGI26466J51736_1005711JGI26466J51736_10057112F096328MTEAAYFWSKEAEKILAPYVQHLVGAESPPTISSPLLAVNWDYSFNDDLLVDLKLACKANIYGRISDKTLADIRKSLENGVLVAVLVPPRLYLLSSWDITWDGTLEALWNRPSVLLPKSVLEQVWSIYERMTN*
JGI26466J51736_1006730JGI26466J51736_10067304F096328VREAAYFWSKEAEKILAPYVQALIGAKEPPTISSPLLASPWDYAFSDDLLVDLKLACKARSYGQISHSTLTDIRKSLESGVMVALFIPPRLYLLSPWDITWDGSLESLYICPSVSVPESVVQQVWSIYNRMTL*
JGI26466J51736_1006746JGI26466J51736_10067464F075803MTSLKALSASPSPAFMRFRTSASEVPNATLWPFLHNLHKPPLHKKLHFRRIPKKAFAIGGFDTTSPRMTLLRSLXEIFWXQGAALERRSXPSXPKGATFLFVYSYITPHXACRFWXAAHLRLHPVLXSRVFIEPSLGEPHPYLICGSTLGTFPILNPEKEPTLPKCSFNSTPPEKNQKGYAYA*
JGI26466J51736_1006765JGI26466J51736_10067652F043237MELGRTARYIAQLSGRGYKYAVVGKLARYDKKLVKRLEYEGFVFYLCRFQTKKEVVEYCLERAEGTFRVYCLASKPLEFPNAPLKLHYDEKTKRLRLLAQRSFINECLKVVERASSLKYPNHKLYTAKLNEALRNLYQILAYTYNDRERLRAIKRKVKHLFVSALKENYGIEPKRAMLDYKNYVVKFSDFLKKKQRGPLNSSTSCPKKLKL*
JGI26466J51736_1009859JGI26466J51736_10098592F023604MAMDIPVSKAAVKSRALEKAALKGMRPSAGEEEEKPWQAYAKEKNLCPVKIDYISN*
JGI26466J51736_1013455JGI26466J51736_10134552F057399VADSTQRFQIMRATRMSRTFEPIATLEGYPYSYVDRDLAPNSYLYRVVRELPSGGRLESEAVEVVVHPVSETEFYVHGGSAPLGEAMLVSWIRSAAEPLTLTLYDQAGRQLYTHHTSSTEGSHLIPSPNATGIYLLEVMGGDFHRTYRLLWY*
JGI26466J51736_1017020JGI26466J51736_10170202F096328IMTEAAYFWSKEAEKILAPYVQHLVGAEEPPEISSPLFAMPWDYSFNGLRVDLKLACKARSYRRISHRTLTDIRKSLESGVMVALFIPPHLYLLYPWGAIWDGSLEFLYTCPSILIPESVVQKVCEIYNRMVL*
JGI26466J51736_1021766JGI26466J51736_10217661F096328TAYFWSKDAEVILAPFVQVLVGAEKPPTISSPLSAANWDYSFDDLLVDLKLACRAGIYGKISDQTLADIQASLRNGVMVALLVPPRLYLLFPYDLTWDGRLETLWNRPSVLVPKNVLEQVWDVYVKMTS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.