NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003665

3300003665: Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM4 Extra Sample 4)



Overview

Basic Information
IMG/M Taxon OID3300003665 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111460 | Gp0101225 | Ga0070392
Sample NameCoalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM4 Extra Sample 4)
Sequencing StatusDraft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size123312788
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCoalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomecoal mineunderground water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationLithgow
CoordinatesLat. (o)-33.460524Long. (o)150.168149Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026607Metagenome / Metatranscriptome197Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
LSCM4Ex_1018248All Organisms → cellular organisms → Bacteria977Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
LSCM4Ex_1018248LSCM4Ex_10182482F026607MMKRFVSTTVALAVALSASAALAATYVTGPLPSEFGGGFIPPNPSILKNVQKASKEGAKLAASVEKCYSKGAANYSKGKATGVSTCLNDPSKGVLPKYQAKINGIASKAPGLPPCAGTPGANGPVIAALVKGFNPQVYCQSPSGAFVDGTASF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.