NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003714

3300003714: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_RNA (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300003714 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0046785 | Gp0088391 | Ga0008272
Sample NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_RNA (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size8238042
Sequencing Scaffolds13
Novel Protein Genes15
Associated Families12

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata3
Not Available2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium4
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → coastal inlet → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000155Metagenome / Metatranscriptome1877Y
F000237Metagenome / Metatranscriptome1498Y
F001099Metagenome / Metatranscriptome778Y
F001583Metagenome / Metatranscriptome668Y
F002870Metagenome / Metatranscriptome524Y
F003081Metagenome / Metatranscriptome508Y
F027881Metagenome / Metatranscriptome193Y
F028311Metagenome / Metatranscriptome192Y
F030104Metagenome / Metatranscriptome186Y
F039672Metagenome / Metatranscriptome163N
F056191Metagenome / Metatranscriptome138Y
F080907Metagenome / Metatranscriptome114Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0008272_100193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1394Open in IMG/M
Ga0008272_100800Not Available972Open in IMG/M
Ga0008272_102246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
Ga0008272_102313Not Available507Open in IMG/M
Ga0008272_102530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
Ga0008272_104282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
Ga0008272_104944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae933Open in IMG/M
Ga0008272_106214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1215Open in IMG/M
Ga0008272_106436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani627Open in IMG/M
Ga0008272_108878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata542Open in IMG/M
Ga0008272_108884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata890Open in IMG/M
Ga0008272_109013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
Ga0008272_111693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0008272_100193Ga0008272_1001932F003081MFNDTRFGAEVFYMHVRGVDTLMVLSYMHILKKIYLKNYVTSESDG*
Ga0008272_100800Ga0008272_1008001F027881KFFVMSLTVARSERVRGVLTHASFTRIKFNLSSARVSNAL*
Ga0008272_102246Ga0008272_1022461F001099KFTASIFAIAAVSAVKLGDDDWFAARENGTGPLDKKYERVPPEHFAAGTDDLFMRSMIMNYALEGKDKDGAPTGVFVMNEAQTKAAAAEVLASHKGIKGGELSSYMETYFPRTWAHYDVNKTGFIGVEAVPMFMRFLASDQTLNLQ*
Ga0008272_102313Ga0008272_1023131F056191LCEARVRHALTAEMFKTLPSWGSMHASVKLEGIDGRAPQERVEHVA
Ga0008272_102530Ga0008272_1025301F002870NKFAKMTLAAMAVEAASVESAQSLVQQALLNVESGSAAAMHLENAMSAMSETKFTDAEILSRNSQNVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKTRGESKDTSDYYNVTVSMMIQRKPVEAAAAPTADPYAPNGAATLASTLDKGFPYDD*
Ga0008272_102574Ga0008272_1025741F000155FAVAALATAQAAKFDSMTEDELLAQLSTHLESAMKSETMGDSDAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQP*
Ga0008272_104282Ga0008272_1042821F039672MAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETRHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESS
Ga0008272_104944Ga0008272_1049441F028311AVKKKSEKRIKKEAYWTRLQVVAQKYNNVLFVDADNVSSKQIAKDQS*
Ga0008272_106214Ga0008272_1062142F030104MSREIRVQLEAVLQTILFILLYWTMAIMAFDDDQEEVIEFMDTSFFNFFSLIIFYLCLKHSIHYFAFLEASVVEGRTVGFIAKQFFRDFLNTFSLILRFYTLLFRMNVYDNLDDFFDSYYIFVGDFDDDEYLNELFLSIHGTLLFTLDNHDDRSFLLEDENDFSNDFFYTYFVV*
Ga0008272_106436Ga0008272_1064362F080907MCAPASNMLFATGMNGDEDLGEDITMKGNKFHFNQNLVQSKFATGMNGDEDLGEDITMKGNKFHFNQNLAQFATGMNGDEDLGEDITMKGNKFHFNQNLVQSKFATGMNGDEDLGEDITMKGNKFHFNQNLAQFATGMNGDEDLGEDITMKGNKFHFN
Ga0008272_106876Ga0008272_1068761F000237ESDG*LLGGYAFL*FQYIIALGISLSASHLSDLTLTIIANIF*SLFNNIYKTYYIIFTNKHLNTDQLTRLMILHYFTP*YYLYLIQLHVLFCHES*DTDSGETTYEDKSGSYVS*FYDCFLKEIQDG*Y*VLFVFVYFFLHHFNGSTVNFFFFER*NIAELDEIRFYGVAPH*YFRPLMGILILAPTHYEGLM*FAVFFGLLAGLPIFYNFYNTFSDYVSTIPMQNSILQTSAFIVFMMSMYCAASMLPCGRYYYDPEGGYVGNP*VKFS*QYMFVYLG*ILHHLDLFDHYIFQFSQTFN
Ga0008272_108878Ga0008272_1088781F001583LLNFTYKTYYILFTNKHLNTDQLTRLMMFHYFTP*YYLYLIQMHVMFCHES*DTDSGENVIEDKSGTYVS*FYDAFLKEIQDAWY*TQFVFLYFAMHHFAPSTVNYHFFER*NISELEEIRFYGVAPH*YFRPLMGLLTIAPTHYEGLA*LVS*FLLLASLPMINHFYNIHNHYIPVIPM
Ga0008272_108884Ga0008272_1088841F001583PGLVVELREEMFNDTRFGAEVFYMHVRGVDTLMVLSYMHILKKIFLKNYITSESDG*MLGGYAFFWFHYIIILGISLSASHLSDLTLTIIANVF*SLFNNIYKTYYIIFTNKHLNVDQLTRLMILHYFTP*YYLYLVKLHVLFCHES*DTDSGENTYEDKSGSYVS*FYDAFLKEIQDA*Y*TLYVFVYFFLHHFNGATVNYFFFER*NIAELDEIRFYGVAPH*YFRPLMGILVISPTHYEGLM*MGLFFILLAFLPIFYNFYNVYHEYVSTIPMQNSLLQTSFFIVFMMSLYCT
Ga0008272_109013Ga0008272_1090131F039672MSLKSKVGTRTFTSKRVVRRLPECSAEVVLSTLLFEEIELLEGLQSVDSEDKRIVGGHTKTVHEFLELDVIEDHSGDVVGVHFSHRLVGLGLNLSGDTVGVSEDSSSDLGAEGSGVVVSLGLGVGDSEREILGDLIKVGLDGGEELSLWVLLNLSSLSSGGLVGSDVLVGNGISSNIWESRNVLNRVWVMVVSLDG
Ga0008272_111693Ga0008272_1116931F002870ALLNVEAGSAAAMHLENAMSAMTQTGFTDAEVLEQHSQKVNVPIDEKRALTLKVSPTYTLDSVNSVTLKSFRKIVGYDTFESIRKKSRGESKDTSDYYNVTVSMMIQRKPVEAAAAPAADPYAPNGAASLASTLDKGFPYDD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.