Sample 3300003757

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003757

3300003757: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof

Overview

Basic Information
IMG/M Taxon OID	3300003757 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118793 \| Gp0095089 \| Ga0041910
Sample Name	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	256997933
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Wastewater Bioreactor Microbial Communities From Cape Town, South Africa
Type	Engineered
Taxonomy	Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Cape Town, South Africa
Coordinates	Lat. (^o)	-33.927	Long. (^o)	18.452665	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099558	Metagenome / Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0041910_1014418	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1811	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0041910_1014418	Ga0041910_10144182	F099558	MSLSNTSYGSLVPSIARRDRNVVGRLLSAVLSQWPERTRGSPPTDTYMRRDIGLSPIEPSRKHWDHQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.