NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004177

3300004177: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 15_LOW5



Overview

Basic Information
IMG/M Taxon OID3300004177 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114290 | Gp0111075 | Ga0066411
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 15_LOW5
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size225594198
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biome → freshwater lake → lake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032328Metagenome180Y
F055534Metagenome138Y
F063813Metagenome / Metatranscriptome129N
F100051Metagenome / Metatranscriptome103Y
F104510Metagenome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066411_1000027All Organisms → cellular organisms → Bacteria → Proteobacteria22527Open in IMG/M
Ga0066411_1000045All Organisms → cellular organisms → Bacteria18746Open in IMG/M
Ga0066411_1008503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1849Open in IMG/M
Ga0066411_1060117All Organisms → cellular organisms → Bacteria667Open in IMG/M
Ga0066411_1080062All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes573Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066411_1000027Ga0066411_100002718F100051MTQRTPTPVLIEAMFTRLLCAVVGHRYVVERVLNHGARKVGCTRCDKHWAMHDGTRAFLLWDEEFEELYAPGGVLAQSDRDLAK*
Ga0066411_1000045Ga0066411_100004512F055534MRNLMNEEEREASHILDLIRYGGDVPASAITWALWVLGDLEAL*
Ga0066411_1008503Ga0066411_10085032F104510MTLHSDARKLNWSMIGVIIALIVQAAALIFWGGGLNQRVSNLERVVAPLADGTLARLDERTKAMKEQLDRIERESGR*
Ga0066411_1060117Ga0066411_10601172F063813ITPCPYGLLWPLYRVRYPIIKTPINEFLTNEEILPIIHKDALMSLVRWSQAHGQKLKPSECESKFQPLAEPSHPSKKPSDQLGSGTGSAPIDETNSIERGLS*
Ga0066411_1080062Ga0066411_10800621F032328LACIVSVGFAQTGSFDIFTYQAPEFFTKSELPTRIQFHLTNKDGSFCTITLYKSLPAKEDLLKVAMSQWNEQVVKRLAKTDKKPTKTLTGQVLDGWTSALSIGNFYQNKKKCVVMLYTFSNNKTSACAVYAFSDKTFKGPIELFSKNLHLPNQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.