NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004179

3300004179: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 4_LOW4



Overview

Basic Information
IMG/M Taxon OID3300004179 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114290 | Gp0111068 | Ga0066404
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 4_LOW4
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size224017928
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019851Metagenome227N
F060098Metagenome / Metatranscriptome133Y
F085867Metagenome111Y
F087391Metagenome / Metatranscriptome110N
F105443Metagenome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066404_1005405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1953Open in IMG/M
Ga0066404_1020371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1064Open in IMG/M
Ga0066404_1033492Not Available843Open in IMG/M
Ga0066404_1060854All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium629Open in IMG/M
Ga0066404_1063407All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium616Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066404_1005405Ga0066404_10054051F105443MGGAERQFTLHLITTTKPPVAPARTSGLPIGAWLVLGFALVIGAFTAASVVSLRSTRGATADLERMQQQFEPLSRSVRDLGDGVATFDRSVLAYLRADTRDRHAATVAAAARLSGAASQMLDVDADDAAPPVGPLLQRIADHEAQGFGLLNMQDERRRAIADLESAFAALDRRVRSAGGSGIVV
Ga0066404_1020371Ga0066404_10203712F087391MKLTKFALLAVAAGCTLASQGVYAQAMEVVTVEAVREIVIGKSPIGAPIKELTIRARVSYADLDLTTATGAATLEKRVRDSATSSCKEIKVDVPVEGWTVDRCIREATEGAMVQVNKAVADAKAAKK*
Ga0066404_1033492Ga0066404_10334921F085867MSERKPELPVGTRAPPRDKPGPPERPLTAREVGPRRGANKIGAATDGWDAYNDWLGRVRQPAPPSRQAVISKSLYSIASYKSWADKARGAFDKGK*
Ga0066404_1060854Ga0066404_10608542F019851VKRPDQVCESCWRVSRASPVPVTEIACHHNKVLATWHADTDEWTYQHRVARKRPTQKQSEQLAQMFDQASSATRRRDEP*
Ga0066404_1063407Ga0066404_10634072F060098MDAPTLKRAASAVTMGLGGLLWLAAILFMAQTAQNSEQFSRLHPWILGINIAG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.