NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004326

3300004326: Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC2A



Overview

Basic Information
IMG/M Taxon OID3300004326 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0110188 | Gp0091623 | Ga0066230
Sample NameSediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC2A
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size26770101
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2
Not Available5

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment → Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)mangrove biome → intertidal zone → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationSao Paulo State, Brazil
CoordinatesLat. (o)-23.8553Long. (o)-46.1394Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016975Metagenome / Metatranscriptome243Y
F030135Metagenome / Metatranscriptome186Y
F042356Metagenome / Metatranscriptome158Y
F043157Metagenome / Metatranscriptome157Y
F067247Metagenome / Metatranscriptome126Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066230_101107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi979Open in IMG/M
Ga0066230_102565Not Available732Open in IMG/M
Ga0066230_103567Not Available650Open in IMG/M
Ga0066230_104110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi618Open in IMG/M
Ga0066230_106747Not Available518Open in IMG/M
Ga0066230_107196Not Available505Open in IMG/M
Ga0066230_107224Not Available505Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066230_101107Ga0066230_1011072F043157VVGDRLMSILDERFRDCICLNMYDRIDSMQMLGELVMIKRAKSLERRIR*
Ga0066230_102565Ga0066230_1025651F016975VSWPGSQADAANTGRSELKSLTRESSGGNALDGPATRPITPLAVENSVG
Ga0066230_103567Ga0066230_1035672F030135KNREELATLSSVTDIWHTTLVGRQFPDAILPGTEAFDLVAGPLD*
Ga0066230_104110Ga0066230_1041102F043157MGILDERFRDCICLNMYDRIDSMQMLGELTMIKRAKSLERRIR
Ga0066230_106747Ga0066230_1067471F067247VRKILSIGIVLALLVTFIVPVAVAAQDECEDPCEWTPPDCAPMPDRTTKTLAGAAMWTMLGVTDVMGKAVCATTGLLACNLGGWSDELGVIAVDVTGTAMDGVAGLLEYVFESFLGMGELGTAVGDLLRGIAGALQGAAE*
Ga0066230_107196Ga0066230_1071961F042356LDESQLPRGYPVATVHQHGAGDSGGFNKPFETAQQKHRKVKQKERPYREGHEDSAGPVKTFRKSAMLKTTPLACERKAT*
Ga0066230_107224Ga0066230_1072241F067247VRKLLSIGIVLALLITFIVPVVVAAQDDECCEWNPPPPVELPDRTTKTLAGATMWTLLGVTDIMGKAVCATTGQMAANLGGWSDELGVIGVDVTVAALEGVSGLLEFVMAEFLGMADLGTSLAELINGIAEALAGATAA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.