Basic Information | |
---|---|
IMG/M Taxon OID | 3300004562 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114290 | Gp0111171 | Ga0066507 |
Sample Name | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 27_LOW6 (Metagenome Metatranscriptome) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 28689644 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas alcaligenes | 1 |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake sediment |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Lake Washington, Seattle, Washington | |||||||
Coordinates | Lat. (o) | 48.3807 | Long. (o) | -122.1599 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001418 | Metagenome / Metatranscriptome | 698 | Y |
F014854 | Metagenome / Metatranscriptome | 259 | Y |
F053640 | Metagenome / Metatranscriptome | 141 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0066507_100697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas alcaligenes | 691 | Open in IMG/M |
Ga0066507_163180 | Not Available | 731 | Open in IMG/M |
Ga0066507_165318 | Not Available | 542 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0066507_100697 | Ga0066507_1006971 | F014854 | LRWTAVIERKSLVVSRIIPGNWGKVEPGWLARPLLDRIARFGGGGRIHQFLWSRSHAVSYAKRNLAARGDKKPLRVGSSSSGRFRAWANRSYPEGKWLLLCIGTGRVTLADSINRLKPPNESHRKVDKGSTRTGKITQARQAA* |
Ga0066507_163180 | Ga0066507_1631801 | F001418 | LAAEAGFTSSSGSVRALSVNAKKELGDEVRLETAPNRVK* |
Ga0066507_165318 | Ga0066507_1653181 | F053640 | VAESTAGIIPGDRGMVGDNWCRPPLQAAKAVERHISPVPLAGVVSGQYTHEVGTERRGAIRNRVEPSQVHGAFRPVRRRSYPRGFWLLLRRPERSHGFRRANPAKRPRSQHERGAQGNRDGGEGAGLAKSVKPPQWGGAKNRVTPLQKRKQP* |
⦗Top⦘ |