NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004826

3300004826: Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods - Norris Mammoth Corridor Bijah Roadside hotspring 3



Overview

Basic Information
IMG/M Taxon OID3300004826 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114622 | Gp0114693 | Ga0071354
Sample NameMicrobial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods - Norris Mammoth Corridor Bijah Roadside hotspring 3
Sequencing StatusPermanent Draft
Sequencing CenterStanford University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size34437390
Sequencing Scaffolds11
Novel Protein Genes12
Associated Families12

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1
Not Available4
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Halodesulfovibrio → Halodesulfovibrio aestuarii1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halobacteriaceae → Haladaptatus → Haladaptatus paucihalophilus → Haladaptatus paucihalophilus DX2531
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. ASF5191
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → spring water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.761133Long. (o)-110.7309Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003460Metagenome / Metatranscriptome485Y
F004367Metagenome / Metatranscriptome441Y
F006183Metagenome / Metatranscriptome379Y
F011301Metagenome / Metatranscriptome292Y
F015070Metagenome / Metatranscriptome257Y
F032666Metagenome / Metatranscriptome179Y
F033339Metagenome / Metatranscriptome177N
F038253Metagenome / Metatranscriptome166N
F039968Metagenome / Metatranscriptome162N
F048124Metagenome / Metatranscriptome148Y
F078015Metagenome / Metatranscriptome117N
F104113Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0071354_100757All Organisms → Viruses → Predicted Viral1372Open in IMG/M
Ga0071354_105923Not Available802Open in IMG/M
Ga0071354_110411Not Available715Open in IMG/M
Ga0071354_121766All Organisms → cellular organisms → Bacteria8309Open in IMG/M
Ga0071354_122565Not Available736Open in IMG/M
Ga0071354_125895All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Halodesulfovibrio → Halodesulfovibrio aestuarii615Open in IMG/M
Ga0071354_130718All Organisms → cellular organisms → Bacteria538Open in IMG/M
Ga0071354_132091All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halobacteriaceae → Haladaptatus → Haladaptatus paucihalophilus → Haladaptatus paucihalophilus DX2531618Open in IMG/M
Ga0071354_138485All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Parabacteroides → unclassified Parabacteroides → Parabacteroides sp. ASF519985Open in IMG/M
Ga0071354_139843Not Available1523Open in IMG/M
Ga0071354_142064All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium606Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0071354_100757Ga0071354_1007571F078015VAHRARSANRSHAALSQREAMNTACITVITAEMLYTFRLKSGDRAQRLACAVLMR*
Ga0071354_105923Ga0071354_1059231F048124MATISIWRGYRDWDAGSDYEIVTYEDAVELGSVRFEDADSDIQYRIIQQCEGGIVVFFVERRGYYCEAEIYEYPTLEDAKKDYAFI
Ga0071354_110411Ga0071354_1104112F039968MRSFDSIFLFRKKPGTASAFILEKRQGDSFAPLETENSKGEKVCYLTKIEGKANAKRRPFWNVTIPKINAKKLGLRTDNLSGIFIPSPEAPNKGFGDCKFTGNGYLFLLGENLETLTILVFRNQCSTVEQVLFTQFLDGEFDAEISEFLEG*
Ga0071354_121766Ga0071354_1217666F033339MFRAKLTKLDDGVMMSTPSPRIRLIYDNRNHATQKEILYVGFTDKGTAEACYSHLLGKGHRHYDRSIDAGMNKPRKAERVDGMAWEIKIHRPTAELVHQFVAKDLARA*
Ga0071354_122565Ga0071354_1225652F038253METHDKNTKGVQEELLQIIQSDEARELIENMVNRMAVLEEAYYRIRELREAVQPYIPEDSEHDEEYWLAAYLVKPHASDVIEKFRQLREIQHKLANLEEQVQEMDNKESSLENNLAKVGSAQEDIGANISKLISEDVDPYLRLGASDFYDLLYESIQEWAAKQLSTERS*
Ga0071354_125895Ga0071354_1258951F104113LKRLNISILIPVSYVDGKPLRESVWTNVIISPEKAAELGLEIKAKSLKTDFQHITEEELAQYGLNVTDSGTVGLTISYDAVGLNKASARQLMSEGLPPRTVYPASSVTNIQLDTADNLITEFDTVDDVKQTEGYRPPSAVSNFVNRMFNKDKTEQPKQTMLDLSLF*
Ga0071354_130718Ga0071354_1307181F032666VSGAGPFPALQSGVLPNQDGIYDLFLSVHPDQNWLTGGSNTSSRWSTLSFSITYDSNYIDFVFRDPGDGSDVFVSNLPVGATFSRYIGARSPASGVAAGQVNAKSGSNVTVTFAVAATSNRNGLTSPPNARGYLRDWFENNYDSELLRVKVNGTAIAALSGQTYSVSPGVQEGNIIIQV
Ga0071354_132091Ga0071354_1320912F004367MSDETKRNGRDGPDQWVEGLLTGAGASIGRVLDERQVHAASLAIEVFAYLLAALPTDRVDLRDVIRMLKFFSGGINNAKGE*
Ga0071354_132091Ga0071354_1320913F003460MPRASRDERYMHDLQHAYEVLHEVLAPRGLHAESSLLLVVNLRRPADLRDVAVELVIRARAGGSPVWRASESLRIPGRMKLRTVSSVLFGLFMRAAYDVEAQISLPGDNRRQPPGGARA*
Ga0071354_138485Ga0071354_1384851F011301MRQPQDKKQPQDKNSPWQILIEIVNRFIAFARRMQQPKGKKLPFQLIHRFIDFVKLTHRSESARESSNIMFSDNELVIISHLEQAATDLRCANPELIEQAKQILAKSSFVSEVSDFKRHLLACVELLLVEVRARQKNPALYDFLHNEGELWYYYNRDKLPNEVVKEIEAYLVYGNPYQTPEEEQEEEKYFEEVIDYFMKRPLSVKAFIREKIQQMPDYERRDFISSQNVKDWISKWHDEYCKVHAHVSMHSFQNMVSEVRKEERKKDQNGR*
Ga0071354_139843Ga0071354_1398432F015070MDEFIGTADYLEIPNWWRCPEWVSLNKEYFTVVVDNLLEFLWDYYLPI*
Ga0071354_142064Ga0071354_1420641F006183VGVPETVMLPPEKVPVTPAGKPENVAPVAPLVLYVIGVIAVFTQTVWLFVPGAEVRVMVLLGRTMMVPVAVTFPQPPVKVTV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.