NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005095

3300005095: Hydrothermal chimney microbial communities from the East Pacific Rise - L vent 8



Overview

Basic Information
IMG/M Taxon OID3300005095 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114640 | Gp0114745 | Ga0072504
Sample NameHydrothermal chimney microbial communities from the East Pacific Rise - L vent 8
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Genomics Institute (BGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size420551688
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHydrothermal Chimney In Epr
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Hydrothermal Chimney In Epr

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biome → marine hydrothermal vent chimney → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationEast Pacific Rise
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088984Metagenome / Metatranscriptome109Y
F103293Metagenome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0072504_101697All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria16068Open in IMG/M
Ga0072504_129017Not Available15845Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0072504_101697Ga0072504_10169724F088984MIAFFRSPSISLWWAHVTDTPDARRTAVFRRGTANGSRGVIPGGGQLQPISGVGDSLLWKNAQKILMKNITSEAMKKIIPQRSPWATTEV*
Ga0072504_129017Ga0072504_12901725F103293MIEIEKLPELPPPYEIYEFQPCQPAYFKVVEFKIGRMTIQPRFPGAPPTKTIAAIRLYVDPKTKKFYPPWYDITPSRLVYQLAGMLTQGIPQGMWLRIHRDVPGPKAHFSVSWVQAPP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.