Sample 3300005107

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005107

3300005107: Cellulose-adapted microbial communities from the Joint BioEnergy Institute, USA - Passage D2F08

Overview

Basic Information
IMG/M Taxon OID	3300005107 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0110122 \| Gp0111702 \| Ga0068702
Sample Name	Cellulose-adapted microbial communities from the Joint BioEnergy Institute, USA - Passage D2F08
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	44587720
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Mesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa
Type	Engineered
Taxonomy	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Cellulose-Adapted → Mesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	USA, Joint Bio-Energy Institute
Coordinates	Lat. (^o)	37.8408	Long. (^o)	-122.2896	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036417	Metagenome / Metatranscriptome	170	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0068702_100041	All Organisms → cellular organisms → Bacteria	100213	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0068702_100041	Ga0068702_10004154	F036417	LPRRRGFAICFRAMVYPARVPLRTRIPTVLVRLATDDGEVVFRARWTRSPLELQRNILFRMRRGSLLWFQDEWGHDLCFRPECVYAAMVDGR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.