NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005220

3300005220: Norris Geyser Basin Crystal Spring 9 - Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods



Overview

Basic Information
IMG/M Taxon OID3300005220 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114622 | Gp0115255 | Ga0073352
Sample NameNorris Geyser Basin Crystal Spring 9 - Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods
Sequencing StatusPermanent Draft
Sequencing CenterStanford University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size759013
Sequencing Scaffolds3
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Adnaviria → Zilligvirae → Taleaviricota → Tokiviricetes → Ligamenvirales → Lipothrixviridae → Deltalipothrixvirus → Acidianus filamentous virus 21
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → spring water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7287Long. (o)-110.714783Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021133Metagenome / Metatranscriptome220N
F071411Metagenome / Metatranscriptome122Y
F080245Metagenome115N
F081547Metagenome / Metatranscriptome114Y
F087442Metagenome / Metatranscriptome110N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0073352_1401All Organisms → Viruses → Adnaviria → Zilligvirae → Taleaviricota → Tokiviricetes → Ligamenvirales → Lipothrixviridae → Deltalipothrixvirus → Acidianus filamentous virus 2916Open in IMG/M
Ga0073352_1717Not Available2872Open in IMG/M
Ga0073352_1786Not Available926Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0073352_1401Ga0073352_14011F071411MSEGDDKMLDILINSADNRTELEKHMDNIAQDLKDNLDDVIENAIDVQLYIDLSTKEPTGFDIGIVIGGPGIRLVYSRGTCKLQGAWGSLNDEKDVDNEICETILDYLTEMYRQ*
Ga0073352_1717Ga0073352_17171F021133MGRRDELIRQIYENGNYAIKKICEMKPDDNMANFSATDCIIGTANTHLALKIAKEKGYPPDVIEYLENQSRQEQWHCRLQIGKPPKLYDFVVAQKHREILLKYGIYVWMGVMPLLGEKIALAKAICWRRNDDPHFVNKFATVDEYYHTTYPLLLLSKYASEEELEKIIELQKEYITNIFKLK*
Ga0073352_1786Ga0073352_17862F080245MIFVWTAKVVMPGFREEIFVSPALINSLGELTEDVYEVGMFAVPHAGHALLFLPTMVINLNDNLMKQLEDTSIEDLNYPLNTIDHVFT*
Ga0073352_1786Ga0073352_17863F087442MMREGLVKAGNLIVDCKPCYIAGTGFTKDDMYVVSEGNVVFKWYDKIAVITVSQEGVKITLVDVIDVRFLVERNENCMVTKL*
Ga0073352_1786Ga0073352_17864F081547YYLSCGIVKGGTLDPETYTVNNPELMMVRLGRDLYIVSNDLKQLIPIEPIKELLASETSKVYNEAMMQGNEVKPA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.