Sample 3300005359

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005359

3300005359: Hot spring microbial communities from Yellowstone Obsidian Hot Spring - Sample 10594

Overview

Basic Information
IMG/M Taxon OID	3300005359 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0045212 \| Gp0052105 \| Ga0074261
Sample Name	Hot spring microbial communities from Yellowstone Obsidian Hot Spring - Sample 10594
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	4270275
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 1	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
Type	Environmental
Taxonomy	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → hot spring → spring water
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Yellowstone National Park, Montana, USA
Coordinates	Lat. (^o)	44.6100594	Long. (^o)	-110.4388217	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000750	Metagenome / Metatranscriptome	908	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0074261_11379	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 1	1582	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074261_11379	Ga0074261_113793	F000750	MIASIVVTAVLFSYWLYKKLAKPKPFQFPIDVQTGDVIHSAFGSLLANLSMQGHLFDVAVGVVLYLAYQIFELTVKKDTIYKDVATFTAGYFITLTAKYIPV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.