Sample 3300005570

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005570

3300005570: Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser CG13 metaT (Metagenome Metatranscriptome)

Overview

Basic Information
IMG/M Taxon OID	3300005570 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111384 \| Gp0115575 \| Ga0073993
Sample Name	Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser CG13 metaT (Metagenome Metatranscriptome)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	21759362
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater biome → aquifer → groundwater
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	USA: Utah
Coordinates	Lat. (^o)	38.9383	Long. (^o)	-110.1342	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012917	Metagenome / Metatranscriptome	276	Y
F014836	Metagenome / Metatranscriptome	259	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0073993_138572	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
Ga0073993_141794	Not Available	556	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0073993_138572	Ga0073993_1385723	F012917	LNGMILFKFLRFPLNDCGYYEKYDSIPEVNRAWDKKKHLKRKRWSQE*
Ga0073993_141794	Ga0073993_1417941	F014836	WTHKENWLQLTEPTWSHFVSISGDNTITVDQERRINELYVGPNRWDTTRLVIDEDLTIVYDDVPEISRVQGYRLPTGVVRLVIQGKGFGFVSEDILVTATEHYENDDDANIEEVEGFMYTCEDTTLTFRDAKIECNIPADHLMPYALNVQVSANGHTTEYALLSEYIK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.