Sample 3300005623

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005623

3300005623: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP2 Nymph Lake 10

Overview

Basic Information
IMG/M Taxon OID	3300005623 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0045212 \| Gp0051341 \| Ga0077576
Sample Name	Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP2 Nymph Lake 10
Sequencing Status	Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	3818442
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
Type	Environmental
Taxonomy	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → hot spring → spring water
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Yellowstone National Park, WY
Coordinates	Lat. (^o)	44.7523206	Long. (^o)	-110.7253926	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075084	Metagenome / Metatranscriptome	119	N
F087445	Metagenome / Metatranscriptome	110	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0077576_10416	Not Available	672	Open in IMG/M
Ga0077576_11152	Not Available	760	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0077576_10416	Ga0077576_104162	F087445	MSASPVKPGDELIQRLLNMSEYELKRVFKMIPIDKRLMLALDTIQEYQNLRSKFDNLFNAFAMNSPKVKEVMENARRTKKPIDRLADMFIDLMETMLKSKAMSLTDEDREKLREKVREMIQNEE*
Ga0077576_11152	Ga0077576_111521	F075084	PYSLGVDYARLLDFTEQNPTGKLFRRAERAMIYARRLLASWYGYDTRMLMETALRRILKKSIIYCNLVKRLGLESQYCKRYTYYDEVPCELVTEYDVEVAYADIMHMISNYNNETTSEILTNMTKECSTYEVR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.