x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300005801
3300005801: Sediment microbial communities of hot springs in Rotorua, New Zealand ? Tikitere hot spring, NZ13 with enrichment
Overview
Basic Information
IMG/M Taxon OID 3300005801 Open in IMG/M GOLD Reference Gs0116259 | Gp0119891 | Ga0079640 Sample Name Sediment microbial communities of hot springs in Rotorua, New Zealand ? Tikitere hot spring, NZ13 with enrichment Sequencing Status Permanent Draft Sequencing Center Oak Ridge National Laboratory Published? N Use Policy Open
Dataset Contents
Total Genome Size 264735176 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Archaea → TACK group → Candidatus Korarchaeota → Candidatus Korarchaeota archaeon 1 All Organisms → cellular organisms → Archaea → Euryarchaeota → Archaeoglobi → Archaeoglobales → unclassified Archaeoglobales → Archaeoglobales archaeon 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Sediment Microbial Communities Of Hot Springs In Rotorua, New Zealand Type Engineered Taxonomy Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Thermal Hot Springs → Sediment Microbial Communities Of Hot Springs In Rotorua, New Zealand
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
Location Information
Location Rotorua, NZ Coordinates Lat. (o ) -38.0631325 Long. (o ) 176.360798 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F103293 Metagenome 101 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0079640_1042099 All Organisms → cellular organisms → Archaea → TACK group → Candidatus Korarchaeota → Candidatus Korarchaeota archaeon 1218 Open in IMG/M Ga0079640_1065321 All Organisms → cellular organisms → Archaea → Euryarchaeota → Archaeoglobi → Archaeoglobales → unclassified Archaeoglobales → Archaeoglobales archaeon 915 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0079640_1042099 Ga0079640_10420991 F103293 MGYIPEDLQKLEELPAPYEIYEFVPGVPAYFEVTDYKIGRIAIHPRWPGAPEEKTIVAIRLYVTPKCKPTSPPYYDITPARLVYALAPILASGKWRGYW Ga0079640_1065321 Ga0079640_10653212 F103293 MGYIPEDLQKLEELPAPYEIFEFVPGVPAYFEVTDYKIGRIAIHPRWPGAPEEKTIVAIRLYVTPKCKPSYPPYWDITPARLVYALAPILASGKWRGYWLRIVRDIPGPKAHFQVSIVTGPEE*
