x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300006149
3300006149: Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t14_698P_inflammed - viral_metagenome
Overview
| Basic Information |
| IMG/M Taxon OID | 3300006149 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0114764 | Gp0121217 | Ga0080712 |
| Sample Name | Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t14_698P_inflammed - viral_metagenome |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Texas Southwestern Medical Center |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 160176588 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information |
| Location | UTSWMC, Dallas, Texas, USA |
| Coordinates | Lat. (o) | 32.73 | Long. (o) | -96.97 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F039198 | Metagenome | 164 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0080712_1015095 | Ga0080712_10150952 | F039198 | MQITSNEISNTKYMQIYLTKDELEKQETKEIIEKYKKEKYHISIFISGKENYPEILEKIIVKQVELNHNVC* |
