Sample 3300006157

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300006157

3300006157: Marine microbial communities from the Red Sea brine-pool Kebit Deep Lower-Interfase

Overview

Basic Information
IMG/M Taxon OID	3300006157 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0116808 \| Gp0121574 \| Ga0082045
Sample Name	Marine microbial communities from the Red Sea brine-pool Kebit Deep Lower-Interfase
Sequencing Status	Finished
Sequencing Center	King Abdullah University of Science and Technology
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	1490213
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Altiarchaeota → Candidatus Altiarchaeales → unclassified Candidatus Altiarchaeales → Candidatus Altiarchaeales archaeon	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Microbial Communities From The Red Sea Brine-Pools
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea Brine-Pools

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Hypersaline (saline)

Location Information
Location	Red Sea
Coordinates	Lat. (^o)	24.7187	Long. (^o)	36.2888	Alt. (m)	N/A	Depth (m)	1469
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076704	Metagenome	117	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0082045_10115	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Altiarchaeota → Candidatus Altiarchaeales → unclassified Candidatus Altiarchaeales → Candidatus Altiarchaeales archaeon	1579	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0082045_10115	Ga0082045_101151	F076704	SAKNESIWNGGRDPLANSLSVDTSVDIEKISVVGRRNPVSLIEGTQELTGSLERNLYSANASYNDIIYENDTTHHELLSATGVYGGSISTCKIILNTTSNEPSADYNRVIYGVKFHSYSTSIASGETVTESVDYSATNLSTS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.