NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006240

3300006240: Marine sediment microbial communities, about 1 km from oil contamination, maybe ambient, Gulf of Mexico ? BC120



Overview

Basic Information
IMG/M Taxon OID3300006240 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0116840 | Gp0121720 | Ga0097669
Sample NameMarine sediment microbial communities, about 1 km from oil contamination, maybe ambient, Gulf of Mexico ? BC120
Sequencing StatusPermanent Draft
Sequencing CenterYale Center for Genome Analysis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size31909919
Sequencing Scaffolds5
Novel Protein Genes7
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine benthic biome → marine benthic feature → marine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationGulf of Mexico
CoordinatesLat. (o)28.3Long. (o)-88.2Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000203Metagenome / Metatranscriptome1619Y
F030135Metagenome / Metatranscriptome186Y
F082867Metagenome / Metatranscriptome113Y
F105419Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0097669_113633Not Available946Open in IMG/M
Ga0097669_117251All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium702Open in IMG/M
Ga0097669_119133Not Available562Open in IMG/M
Ga0097669_128401All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium654Open in IMG/M
Ga0097669_128904Not Available729Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0097669_113633Ga0097669_1136331F082867SSLSIPKERKMPKKKKNSRSRRVHHINDINHNDTNITVQYRVVKPLTFTSNTLVLSVNPALTDLSNTLATIYRQYRVTELSFTFQASSDAGAYALAMQYVPQIGGTPSTLPTLLSEFEGPAVGYYETGRGREYTFRVPSDVLNAMGLNYYSTRTAVTPIQDPDILTQGLMVFLTSSPNIPVVAYMHVKYEFQTLEDPSFLASLFDDKKQDNDMLVVPRPSLNSVGDAKGATWDENARGRIRGQSLGNNHFSSVTQP*
Ga0097669_114627Ga0097669_1146271F000203LFPMCWHLALGLFRKPAVSFPTPFSTASGVYGLVAGPDSPFLAGLFE*
Ga0097669_114629Ga0097669_1146291F000203LFPMRWHLALGLFRKPAVSFPTPFSTASGVYGLVAGPDSPFLAGLFE*
Ga0097669_117251Ga0097669_1172512F105419MKKFIILSAFVAAAVTFTGLTNGCISNTKYGCDVTETLAPGASEGEVVMKHGAPDNIVYLGTPYFNPTTGERGEVDKYLYEYRIGGGTTLLGQLFADDRFHNICYLIEGGRVMGGGYVGEGSGSIIMGNAGISTPLGTLFEFGGFL
Ga0097669_119133Ga0097669_1191331F030135REELATLSSFTDIWHSTFVGRQFPDAILPGKEAIDLVAGPLN*
Ga0097669_128401Ga0097669_1284011F105419QVGAAVAFQVKTLAILANREAKKEKKDMKKFFVLSAFLAAAVAFTGLSNGCISNTKYGCDVTETLAPGASEGEVIMKHGAPDNIVYLGSAYFNPQTGERGEVDKYLYEYRIGGGTTLLGMLFADDRFHNIAYLIEGGRVMGGGYVGEGSGSIIMGNDGITLPVIGKVMQFGGFLHPKARAGYGGDGTPSGGADVPENKG*
Ga0097669_128904Ga0097669_1289041F030135EGLKDREELATLSSITDIGHSTFAGRQFPDAILPGREAVDLVAGPLN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.