 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006300 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114560 | Gp0113277 | Ga0099592 |
| Sample Name | Prairie soil microbial communities from Kansas, USA, after rainfall - K06 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Oregon State University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 59489001 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1 |
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Prairie Soil Microbial Communities From Kansas, Usa, After Rainfall |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Prairie Soil → Prairie Soil Microbial Communities From Kansas, Usa, After Rainfall |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → prairie → bulk soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Konza Prairie, Kansas, USA | |||||||
| Coordinates | Lat. (o) | 39.1038 | Long. (o) | -96.6133 | Alt. (m) | N/A | Depth (m) | .2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004509 | Metagenome / Metatranscriptome | 435 | Y |
| F101805 | Metagenome / Metatranscriptome | 102 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0099592_10059651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 535 | Open in IMG/M |
| Ga0099592_11090778 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 605 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0099592_10059651 | Ga0099592_100596512 | F004509 | LQLINPSTLPNELNTTLTPHSIIHGDACFAYFNKIWGIP |
| Ga0099592_11090778 | Ga0099592_110907782 | F101805 | MSTYLSTTDVFLAPTPEIRALHDKSILIVTPSGDQMWAKICVEDADPGGRDAGKCSVIVWTASTDEREWVDARSGRPPPPTESHRWPQFLTSDAVKLIRPNEENPAYDLLLQLATEEI* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |