 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006302 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052472 | Ga0099621 |
| Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159814214 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 42136310 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 473 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054109 | Metagenome | 140 | N |
| F077404 | Metagenome | 117 | N |
| F105378 | Metagenome | 100 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0099621_101974 | Not Available | 4198 | Open in IMG/M |
| Ga0099621_102853 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 473 | 2987 | Open in IMG/M |
| Ga0099621_111673 | Not Available | 640 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0099621_101974 | Ga0099621_1019742 | F054109 | MAGRPKSKKGVKVHTAFKIYSDDKVRAQAMADKLDMSLSSYINKAVLEKVARDEKSEN* |
| Ga0099621_102853 | Ga0099621_1028532 | F077404 | MNILKTAFAFFFALCFMMGANSYAQTTNRINAEASKRELKRNAIYIPPALEEYADTILLHQRFIVENKGNYLYTPFTKDNEPSIPFNYGFLHPLGERFYNSFMGKVDRILRPKEDKGFIILTNYLVVLDDKYAFDTSNKDTSKLADLKYLDFRRIKSDFSYGHPYQGFTDYDRVELSYFVQSYGRQAALETANTWVMASYPFSLQSTKFENLYTRGRKLILTDGKTTLSLYFLMIDSVALNFDTKVLPYIKGVFRFNRIQ* |
| Ga0099621_111673 | Ga0099621_1116731 | F105378 | MKVSVYVDKLKKWVPISSDEILDRNKNLSDVKDKDAAITNLGLYDKFISKEALQSGFLPDVFTPENIQTDADHQFVSDSDKNNWNNKLNKPVEIQTNLEENQIGYDEVNEKFYIGLNNKNVLIGGASALDNIKIVNGFFSGNSQPTIIRNTKTREDGTLISPVFVDVQCVEYTGGDLGEVSVSYT |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |