NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006883

3300006883: T10 (1) BES, Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times



Overview

Basic Information
IMG/M Taxon OID3300006883 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117429 | Gp0125656 | Ga0102488
Sample NameT10 (1) BES, Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size42409902
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon1
All Organisms → cellular organisms → Archaea1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biome → river → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047387Metagenome / Metatranscriptome150Y
F048390Metagenome / Metatranscriptome148Y
F059489Metagenome / Metatranscriptome134Y
F092111Metagenome / Metatranscriptome107Y
F102132Metagenome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0102488_110422Not Available752Open in IMG/M
Ga0102488_111811All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.698Open in IMG/M
Ga0102488_113471All Organisms → cellular organisms → Bacteria641Open in IMG/M
Ga0102488_114687All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon606Open in IMG/M
Ga0102488_115342All Organisms → cellular organisms → Archaea588Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0102488_110422Ga0102488_1104222F048390VILRYHMVRFVRTLQHRVTPKGRDFYALSIPPQVAEALNLKAGGAVSICVNPVKTGTFEVTIKAVSDELS*
Ga0102488_111811Ga0102488_1118111F092111VTPEEEGSDVREMVWEMSRTTNKILIFGIILILAILAVLMYCGIITFPSLTNGLINITK
Ga0102488_113471Ga0102488_1134712F102132MNTQTVVKNLESAINRICKDIKDKKGGSGADKLDSLAKLVNAYSRLIERDKEKEIDPMEDGDPNYYKKLEARQTDRRGIIR*
Ga0102488_114687Ga0102488_1146871F059489AMTQSNDQHAVDVDTYISKNSRFKSFVYDRGEIQTIAENLGFKTDHVRTEIRKLGYRLIKNSSHGRMIWKRDQLERTSLTIAGI*
Ga0102488_115342Ga0102488_1153422F047387MHAIDIRTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.