Sample 3300007067

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300007067

3300007067: Ant gut microbial communities from Cephalotes spinosus, Peru

Overview

Basic Information
IMG/M Taxon OID	3300007067 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117930 \| Gp0126575 \| Ga0103266
Sample Name	Ant gut microbial communities from Cephalotes spinosus, Peru
Sequencing Status	Permanent Draft
Sequencing Center	Harvard University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	55750902
Sequencing Scaffolds	0
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut

Location Information
Location	CICRA, Madre de Dios, Peru
Coordinates	Lat. (^o)	-3.6347588	Long. (^o)	-70.1	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054614	Metagenome / Metatranscriptome	139	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103266_1022773	Ga0103266_10227732	F054614	MSLLLTLTGKSNVLATTYFPAIDLSDDDYELGLMNFETYNTISNVNASNNKFYFGENDVEITIPEGSYELHAINDF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.