NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007155

3300007155: Iron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - ECH_C_top_diel_T=5 metaT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300007155 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0067861 | Gp0123761 | Ga0099843
Sample NameIron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - ECH_C_top_diel_T=5 metaT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size11314365
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSaline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springmicrobial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7219Long. (o)-110.7021Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053392Metagenome / Metatranscriptome141N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0099843_126181Not Available1076Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0099843_126181Ga0099843_1261813F053392VRRMSVPSYVTLTGPQTTVMPASFTIAASALAGTVVQGSILAFGPQSPAVAAPQVPITEVWSIVDLYIIGTVTPDALLSIYINGYPQDINPDLNSLNLNNLTRWKLMQALKLPPASTWFTTITLLGANGTSQQTYTVYFSVIRAPYLPSASSK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.