NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007156

3300007156: Iron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_top_diel_T=5 metaT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300007156 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0067861 | Gp0123755 | Ga0099837
Sample NameIron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_top_diel_T=5 metaT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13616744
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral2
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSaline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → microbial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7315Long. (o)-110.7113Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026924Metagenome / Metatranscriptome196Y
F027904Metagenome / Metatranscriptome193N
F067921Metagenome / Metatranscriptome125N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0099837_101100All Organisms → Viruses → Predicted Viral1115Open in IMG/M
Ga0099837_103950Not Available1509Open in IMG/M
Ga0099837_129335Not Available590Open in IMG/M
Ga0099837_132685All Organisms → Viruses → Predicted Viral1857Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0099837_101100Ga0099837_1011003F027904MVVKMEKYNPPEYDLFNLNNGSTLVGTSPVTLLYEGQPNATVVVPPDLTLRVKQVIIQNTTSSVITVQLQAVTTQTGLPSPVNKTPPIPVPASSAVTLDEDEWSINVKTGYSLAAVSSAANSANVFVKAYFVKGTGSPI*
Ga0099837_103950Ga0099837_1039502F067921MESFERVDDRLLRNGQYLLVSYSGAKNPAQAMFTGFRVVKHNVTTLYYNFATEVPNFLPMAPYGTSPGPTNSPPYIDNFSFSLQEVKNVTDMFDITKTGDAYQVFYGISPSYLRVMNKVQRQFVSVLEQNIYPSNSFVEMGVDGFQSPLNNPSAKTEFIVFVNLTYNVTLMNTATIPIMPAFNFVINRMTLEPLGQAELKKAILAGFPIRSLGAVDSSIMISPDNYPGLVTLSYREIYGG
Ga0099837_103950Ga0099837_1039503F027904MEKYEPPEYDLFNLNNGSTAIGTTPAPLLYEGQANAAVIVPPDLTLRVKQVIIQNATTSLITVQLLAVTTVSGAPTPVAKTPPIPVPASSAVTLDEDEWSISVKSGYSLAAV
Ga0099837_129335Ga0099837_1293352F026924MSVGKVCWREHYKFEASKIVHLGRHGFHIPVIVYGHDPDPEKAQEDLCINMVGIYEPIGSFRENQLILPPKKGERV*
Ga0099837_132685Ga0099837_1326853F027904VQCKYEPPTYDLFNLNNGSTLVGQSPVTLLYEGQPNATVYAPPDLTLRAKQIIIQNATTSPITVQLLAVAAPNTSLPGPIPKTPPIPVNAGSAVTLSEEEWGIAVRSGYGLAAVSSAANSANVFVKCYFTKGTGMPV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.