NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007786

3300007786: Human attached/keratinized gingiva microbial communities from NIH, USA - visit 1, subject 763961826 reassembly



Overview

Basic Information
IMG/M Taxon OID3300007786 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052837 | Ga0105676
Sample NameHuman attached/keratinized gingiva microbial communities from NIH, USA - visit 1, subject 763961826 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size20638031
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Attached/Keratinized Gingiva → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081456Metagenome114N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0105676_104013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes988Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0105676_104013Ga0105676_1040132F081456LGYRLFLEKGAHMFEEPPIYYILISLIFLIVFGAISFATWLVWLTNVALFVKLVITAIGALFAAMTVILYTISAE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.