x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300007888
3300007888: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764487809 reassembly
Overview
Basic Information
IMG/M Taxon OID 3300007888 Open in IMG/M GOLD Reference Gs0063646 | Gp0052985 | Ga0111236 Sample Name Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764487809 reassembly Sequencing Status Permanent Draft Sequencing Center Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis Published? N Use Policy Open
Dataset Contents
Total Genome Size 26906299 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae 1 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
Location Information
Location USA: Maryland: Natonal Institute of Health Coordinates Lat. (o ) 39.0042816 Long. (o ) -77.1012173 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F077405 Metagenome 117 N F077781 Metagenome / Metatranscriptome 117 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0111236_100464 All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae 6496 Open in IMG/M Ga0111236_108941 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan 610 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0111236_100464 Ga0111236_1004641 F077405 LLVAKQRGVFYGFISLCQIKFVKKVFDCLKIVQK* Ga0111236_108941 Ga0111236_1089411 F077781 APARPASAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLYLGFPRPHPGTPGPGRFWAFLALQSLSETPSHARMPRVTVARTSPGTIEISPLRAAT*
