Sample 3300008310

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300008310

3300008310: Microbial communities from the gut of humanized mice in USA - PM96.FECAL.14dpc

Overview

Basic Information
IMG/M Taxon OID	3300008310 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117949 \| Gp0126140 \| Ga0103551
Sample Name	Microbial communities from the gut of humanized mice in USA - PM96.FECAL.14dpc
Sequencing Status	Permanent Draft
Sequencing Center	CCME-COLORADO
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	9281056
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Communities From The Gut Of Humanized Mice In Usa
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities From The Gut Of Humanized Mice In Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut

Location Information
Location	USA
Coordinates	Lat. (^o)	38.65	Long. (^o)	-90.26	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047125	Metagenome / Metatranscriptome	150	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0103551_100064	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii	2123	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103551_100064	Ga0103551_1000642	F047125	MDVVLLLMVLGVMSSGFWAADALDHMRKEILQQEGKRRGWWS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.