NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008414

3300008414: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 686765762 reassembly



Overview

Basic Information
IMG/M Taxon OID3300008414 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053260 | Ga0115230
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 686765762 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size24153383
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1
All Organisms → cellular organisms → Bacteria → Fusobacteria → Fusobacteriia → Fusobacteriales → Fusobacteriaceae → Fusobacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027205Metagenome195N
F105380Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0115230_100391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7878Open in IMG/M
Ga0115230_101386All Organisms → cellular organisms → Bacteria → Fusobacteria → Fusobacteriia → Fusobacteriales → Fusobacteriaceae → Fusobacterium2026Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0115230_100391Ga0115230_1003911F027205VKGPRGLPLIERTHVASRLIVSADDILKAVKESEAFERKALSEARKRDRAEGKEPRETLYPNPDLKPGREIVLDYIKNPERRRTPRCSVHLEKRTANNSYRFIVDVSQVRNRELADEIEKDLFAFMDYLLDEYDIPRRIKRSTK*
Ga0115230_101386Ga0115230_1013863F105380ITMTIVELDTSQYVKQGRIFKKFESNLLDSYMDGRQTKYNINLADLDDQISDGIVYADKTGKMIYKFSAKKIVQTAITKDLTISGLADEFKMDYYSFWVPDIYLLSYSGFNPGNGLCLAYRKKYEEYICLTNIFPERREQENSYFPNGKKLETKSICTGSMMADIDSAEYAAWKNDAVTRASQYVNKFLSARGNADLNFVSSSLRSKVPSHDMKKFAEFLGSITKEQENVNTYEEFIEWTKNTKWLK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.