NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008720

3300008720: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159753524 replicate 1 reassembly



Overview

Basic Information
IMG/M Taxon OID3300008720 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053328 | Ga0115616
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 159753524 replicate 1 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size27464340
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus1
Not Available1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-781
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006329Metagenome / Metatranscriptome376Y
F027342Metagenome195Y
F032472Metagenome / Metatranscriptome180Y
F059631Metagenome133Y
F063778Metagenome129Y
F076912Metagenome117Y
F097527Metagenome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0115616_102159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus2041Open in IMG/M
Ga0115616_103002Not Available1606Open in IMG/M
Ga0115616_105489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii1010Open in IMG/M
Ga0115616_106183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces924Open in IMG/M
Ga0115616_106749All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78860Open in IMG/M
Ga0115616_110148All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum614Open in IMG/M
Ga0115616_111922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae531Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0115616_102159Ga0115616_1021595F097527MIYFKMEKIGNSTKTEKKKTRSENLVIITIPAAGVEPARPCGHWIL
Ga0115616_103002Ga0115616_1030022F076912LGKSALLSNGKGSNADKVQDSETSLLVSKKADKNYLDDSEGTQKSCLDVVFELLATTAGTSSSNSLPESVRFLESQLQVERHRSDVMRQEAEGLRKSLQNSDAYFLVQQQALEDLSAKQEKVNKLAKHLASIMGTQDIVS*
Ga0115616_105489Ga0115616_1054892F006329ERLNLVEEENNYLKEKIKNKEEKMILELHVADVVDDHKIKMDAMRLKIRKIRKYAIDTEAWYHYAVGSIVTLVAIMIAFVFALKCFT*
Ga0115616_106183Ga0115616_1061831F063778SEGTKQQLLQQLQNALGLVADADTSAHDVAAITQSAADGHQLTEVMLQQMTAIEAYLKNCQTSINDAIDNIEAIPLDPPPED*
Ga0115616_106749Ga0115616_1067491F032472MAPPIINNDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFEPQPSAPHCHDGHDLALQPDSTLEAALESAPIFNSKPAAQIEDGWLDTASGATISTAIEPNTIPVPCKARDSEVLDSIPDSEYSAPLPIEPDWALIMEFTTADIFQHSPF
Ga0115616_110148Ga0115616_1101481F027342LESKAQAAELATALETANFAKAEAQKALQELEEMRKIAAGKAFFMQSKHVSFNCLLLTRIRSSPGAFADLPHSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHSVPLSDQLKQLVELHKAAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALAHAKVHWGKLDAEKLVKDGRLLVITGCGLAACS
Ga0115616_111922Ga0115616_1119221F059631LWLKTFSVKPKVVKGSQAECGGAMVGRMSHVTCLEGTFVETIKGWQSGWFYITEPRDPEWAVAPEFRSGFPTQLTSWKEKGLLWGSSEELTGLQACIQKLVNKKLKLVNIVQVMLIRRILPCQHRACNLWEFDPAKHQTLRELFGSSHKDIWKVLFKSGKSWPDSAEDRGYQLSRPA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.