NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008880

3300008880: Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_3059



Overview

Basic Information
IMG/M Taxon OID3300008880 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117986 | Gp0126487 | Ga0103898
Sample NameMicrobial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_3059
Sequencing StatusPermanent Draft
Sequencing CenterMassachusetts Institute of Technology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6845012
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysurface water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000075Metagenome / Metatranscriptome2622Y
F001926Metagenome / Metatranscriptome616Y
F101219Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103898_100295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae785Open in IMG/M
Ga0103898_101109Not Available531Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103898_100295Ga0103898_1002952F001926VRHEDIPDMSNPKTTKAVLEGDKLMKEVLNGGYNVHPVPPPNSETKERSARKYERKRTKIEKLFTLGYTTSGDP*
Ga0103898_101109Ga0103898_1011091F101219ISLPLVFATFFFVWKKQALEVTPESFQEERTQPVDDQVVEPVAPSMAKVENTESEVAQLGSHEKPVEKIDNDIRIAPSQAPPVGNSKPRVLEILEDVKIAIKESVIKNAEGNQALDTRISLVETSMKHPLMILEEKGTKFGQTGEEVIKANAHVATHFMLQVVPGTNLLALEEKLS
Ga0103898_101268Ga0103898_1012681F000075AALIATVAANRYENMNEDDLLVNLESTLSSALSSEARGDADAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQPQINDMERRLGIMQSVEPVLENAIKTLQKVVDVRGMGKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.