 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009322 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117984 | Gp0126433 | Ga0103844 |
| Sample Name | Microbial communities of water from the North Atlantic ocean - ACM31 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Georgia |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 12527026 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → surface water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033052 | Metagenome / Metatranscriptome | 178 | Y |
| F093788 | Metagenome / Metatranscriptome | 106 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103844_100436 | All Organisms → Viruses | 982 | Open in IMG/M |
| Ga0103844_101001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| Ga0103844_103038 | Not Available | 501 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103844_100436 | Ga0103844_1004361 | F093788 | PNLSITTMTEFNPRSYILTQLAYAEEQLMIADDMTSKLTWGNRCDALEAALADLEAA* |
| Ga0103844_101001 | Ga0103844_1010012 | F033052 | MEIINEIANILIFINATLFYIFVFGREIKALARLNKMEKILLRVGLSIPSMGALYNVLVGQYPPIPEIIINVGYASLWTWASIFHYNTFVKNGK* |
| Ga0103844_103038 | Ga0103844_1030384 | F093788 | PNLSITTMTEFNPRSYILTQLAYAEEQLMIADDMYSKITWGNRCDALEAALADLEAA* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |