NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009324

3300009324: Microbial communities of water from the North Atlantic ocean - ACM48



Overview

Basic Information
IMG/M Taxon OID3300009324 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117984 | Gp0126435 | Ga0103846
Sample NameMicrobial communities of water from the North Atlantic ocean - ACM48
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Georgia
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25148342
Sequencing Scaffolds6
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → Viruses2
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → surface water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000237Metagenome / Metatranscriptome1498Y
F001971Metagenome / Metatranscriptome609Y
F016277Metagenome / Metatranscriptome248Y
F019233Metagenome / Metatranscriptome231Y
F031118Metagenome / Metatranscriptome183N
F033052Metagenome / Metatranscriptome178Y
F070150Metagenome / Metatranscriptome123N
F093788Metagenome / Metatranscriptome106N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103846_100991All Organisms → cellular organisms → Bacteria968Open in IMG/M
Ga0103846_101292All Organisms → Viruses886Open in IMG/M
Ga0103846_101866All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage786Open in IMG/M
Ga0103846_103310All Organisms → Viruses649Open in IMG/M
Ga0103846_103913All Organisms → cellular organisms → Bacteria → Proteobacteria611Open in IMG/M
Ga0103846_104243Not Available593Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103846_100991Ga0103846_1009911F031118VVTQSRCEALAEILAEAEKLKMYRLDGSTYCEKCHNLVVRIQSVLEDVKVEDLSADDIEKIKAIKEKVIGEEVFAESSSILRNPKEWLGTLNE*
Ga0103846_101061Ga0103846_1010611F000237AFL*FHAIIFLGISLSATHLSDLTLTVFANVF*SLINNIHKTYYIIFTNKHLNIDQLTRFMMLHYFTP*YYLYLIQMHVLFCHES*DSDSGETTYEDKTGTYLS*FYDAMLKEFQDG*Y*VLYIFVYFSLHHFNGGTVNYFFFER*NIAEMDEIRYYGVAPH*YFRPLMGMLIVCPTHYEGVF*LLLYLVLIASLPLFYNFYNTFNKHVPAIPMQNSLLQTTAFILFMMSMYCAASILPCGRYYYEPEGGYVGNP*IKFSFQYIYLYLG*ILHHLDVLDHHIFQFSQTFIRKCSSYSMRTNLLRKTNSSKKVNRK
Ga0103846_101292Ga0103846_1012924F016277LTYYINRQEGRYDETCDEYDTRHEAYAMMREYQVSDHGRAYYYLSTTPKENWID*
Ga0103846_101292Ga0103846_1012926F093788LNLSITTMTEFNPRSYILTQLAYAEEQLMIADDMTSKLTWGNRCDALEAALADLEAA*
Ga0103846_101866Ga0103846_1018662F033052VINFLKINSMEIINEIANILIFINATLFYIFVFGREIKALARLNKMEKILLRVGLSIPSMGALYNVLVGQYPPIPEIIINVGYASLWTWASIFHYNTFVKNGK*
Ga0103846_103310Ga0103846_1033102F001971MTYEEFIHKGTEFYMDMVRLVDIKLKHRMDFTDDEIEIKDYIMEFQKQVKINELRDKFQKCWEVDE*
Ga0103846_103913Ga0103846_1039132F019233MATLNFIMPRDLKDGFCEREEKQHKVQHSWLPSGQTRAIFGDEIAIECYCKHCGQREWTQTSRFEFEMLQDYWKELR*
Ga0103846_104243Ga0103846_1042432F070150MKLILAGIFAVALVYFLTANSVLQRVSYDIYECDHRTAGKIKLWFKKVETGERFEFTKDMQSKFLSIEDVSDNKVAFLDENAFFKLDLASLRLVRDEKGEVVFFTCKLNAFRM*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.