NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009456

3300009456: Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov



Overview

Basic Information
IMG/M Taxon OID3300009456 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118459 | Gp0138845 | Ga0127523
Sample NameMicrobial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Texas, Austin
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size151513780
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Myzus → Myzus persicae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHost-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
TypeHost-Associated
TaxonomyHost-Associated → Insecta → Unclassified → Unclassified → Unclassified → Ribes Sp. → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationPocatello, ID, USA
CoordinatesLat. (o)42.899137Long. (o)-112.461301Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060091Metagenome133Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0127523_103103All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Myzus → Myzus persicae3584Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0127523_103103Ga0127523_1031032F060091MSVSDSMMAENLINLSSESDSDDEFDELILLYSLTKQKKMWKSNFMKKRQSHGEFNLSSEFSDKQFLNYFRLDRKQFNEVLHLIRDTIYSFGCNAQKPIDPEEKLAVFLR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.