x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300009456
3300009456: Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov
Overview
Basic Information
IMG/M Taxon OID 3300009456 Open in IMG/M GOLD Reference Gs0118459 | Gp0138845 | Ga0127523 Sample Name Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov Sequencing Status Permanent Draft Sequencing Center University of Texas, Austin Published? N Use Policy Open
Dataset Contents
Total Genome Size 151513780 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Myzus → Myzus persicae 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa Type Host-Associated Taxonomy Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Ribes Sp. → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal corpus
Location Information
Location Pocatello, ID, USA Coordinates Lat. (o ) 42.899137 Long. (o ) -112.461301 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F060091 Metagenome 133 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0127523_103103 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Myzus → Myzus persicae 3584 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0127523_103103 Ga0127523_1031032 F060091 MSVSDSMMAENLINLSSESDSDDEFDELILLYSLTKQKKMWKSNFMKKRQSHGEFNLSSEFSDKQFLNYFRLDRKQFNEVLHLIRDTIYSFGCNAQKPIDPEEKLAVFLR*
