 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009967 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120447 | Gp0151224 | Ga0133780 |
| Sample Name | Termite gut microbial communities -laboratory nest Belgium. Combined Assembly of Gp0151224, Gp0151225, Gp0151226, Gp0151227 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Luxembourg Institute of Science and Technology |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 215628660 |
| Sequencing Scaffolds | 18 |
| Novel Protein Genes | 22 |
| Associated Families | 18 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2 |
| Not Available | 11 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica | 2 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Aculeata → Apoidea → Apidae → Apinae → Meliponini → Melipona → Melipona quadrifasciata | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Multi-Omic Termite Study |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Belgium | |||||||
| Coordinates | Lat. (o) | 50.814939 | Long. (o) | 4.383499 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000028 | Metagenome | 5420 | Y |
| F000034 | Metagenome | 4504 | Y |
| F000148 | Metagenome | 1916 | Y |
| F000253 | Metagenome | 1454 | Y |
| F000394 | Metagenome | 1186 | Y |
| F000963 | Metagenome | 820 | Y |
| F001073 | Metagenome | 786 | Y |
| F002790 | Metagenome | 530 | Y |
| F006510 | Metagenome | 371 | Y |
| F007951 | Metagenome | 342 | Y |
| F010252 | Metagenome | 306 | Y |
| F014568 | Metagenome | 262 | Y |
| F019385 | Metagenome | 230 | Y |
| F032700 | Metagenome | 179 | Y |
| F047149 | Metagenome | 150 | Y |
| F050459 | Metagenome | 145 | Y |
| F052010 | Metagenome | 143 | Y |
| F069311 | Metagenome | 124 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0133780_1001737 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota | 2335 | Open in IMG/M |
| Ga0133780_1004569 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2455 | Open in IMG/M |
| Ga0133780_1006708 | Not Available | 509 | Open in IMG/M |
| Ga0133780_1007875 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 529 | Open in IMG/M |
| Ga0133780_1008663 | Not Available | 1072 | Open in IMG/M |
| Ga0133780_1019228 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica | 977 | Open in IMG/M |
| Ga0133780_1027265 | Not Available | 625 | Open in IMG/M |
| Ga0133780_1030561 | Not Available | 1436 | Open in IMG/M |
| Ga0133780_1043887 | Not Available | 514 | Open in IMG/M |
| Ga0133780_1062396 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus | 824 | Open in IMG/M |
| Ga0133780_1068557 | Not Available | 927 | Open in IMG/M |
| Ga0133780_1081474 | Not Available | 641 | Open in IMG/M |
| Ga0133780_1110536 | Not Available | 640 | Open in IMG/M |
| Ga0133780_1119139 | Not Available | 1796 | Open in IMG/M |
| Ga0133780_1152916 | Not Available | 676 | Open in IMG/M |
| Ga0133780_1251151 | Not Available | 1042 | Open in IMG/M |
| Ga0133780_1310491 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Aculeata → Apoidea → Apidae → Apinae → Meliponini → Melipona → Melipona quadrifasciata | 631 | Open in IMG/M |
| Ga0133780_1441498 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica | 503 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0133780_1000544 | Ga0133780_10005441 | F000034 | SLRFITYRLNTAQHVSGILMPIIRSSITAVAASGLPLERGGSSAVDRGNSNKPERLLHLVG* |
| Ga0133780_1001737 | Ga0133780_10017372 | F000394 | MFLDRTQRRGTVGGTPLDEWSARRGGLCLTTHDTHN |
| Ga0133780_1004569 | Ga0133780_10045691 | F069311 | MLVITVQTTIPVKEIDDRITAAVFFVASVLWDLKFHFGSVFKIMNLE* |
| Ga0133780_1006708 | Ga0133780_10067081 | F000253 | MFLDRTRRRGAVGGSPLDEWSARRGDLCLTTRDTHNRQVSMP |
| Ga0133780_1007875 | Ga0133780_10078751 | F007951 | FRPFWEMFCEQQDNSVIHAFHMGKYMLHAQESETLQTFTFRLLKGKQRTSVTFQTDSNIPISLHVFAFLLIVEEDIVFIHDAAFFFLGVCAFA* |
| Ga0133780_1008663 | Ga0133780_10086631 | F001073 | AAHYKKDNLLNCWNSSSDISGYHADFHEGHGTVGTGQGRDMACVN* |
| Ga0133780_1019228 | Ga0133780_10192281 | F010252 | PCKKITLDKPEGRRRVGRPNFRWMDGVMRDAERLGVRNWRSKAKDRDGWRRLLELAKTLHGL* |
| Ga0133780_1027265 | Ga0133780_10272651 | F000394 | MSYIYMEHPFLMFLDRTRRRGTVGGTPLGGWSARRGGLCLTAHDTHT |
| Ga0133780_1030561 | Ga0133780_10305611 | F052010 | ATGRATLAGQVEGDGPDERGYPGPPGWGLRVRLTTSPRKKTNCYETLQ* |
| Ga0133780_1043887 | Ga0133780_10438872 | F000963 | SKCRLFHNDTLFGSRVIHILHTGVLKFKCKIWVPKG* |
| Ga0133780_1062396 | Ga0133780_10623961 | F019385 | VQNRAAKFANNINESGWETFAQCRLIARICTLFKAYTGRRAWKAIGDRLLKSCYLSRGDHNRKIRTRKQRTDVGKYSFVNRTIKSWNQLPASLLASFPCKLQIFRKRVKNVVTSKEIQVGIECKK* |
| Ga0133780_1068557 | Ga0133780_10685571 | F000394 | MEHPFLMFLGRTRRRGAVGGTPLDEWSARRGGLCLATRDAHN |
| Ga0133780_1069835 | Ga0133780_10698352 | F000148 | MFNPLNPELNPICYLLALLAHQFLHVSRIWVKSLTLRLLMSYIYIYGVPILD |
| Ga0133780_1081474 | Ga0133780_10814741 | F014568 | ALLSPGSDGEPEAATAVVVVPDDGHGDARSVLSRVYLTGDRLERLLLLDG* |
| Ga0133780_1110536 | Ga0133780_11105361 | F002790 | LLVMGGRTPEACRAVDRRQDDKLKSCCIGLVIYLN* |
| Ga0133780_1119139 | Ga0133780_11191393 | F000253 | MEHPFLMFLDRTRRRGTVGGTPLDEWSARRGDLCLTAHDAHNGQVSVPSVGFE |
| Ga0133780_1152916 | Ga0133780_11529161 | F000394 | MFLDHTQRRSGVGGTPLDEWSARRGDLCLTARDAH |
| Ga0133780_1251151 | Ga0133780_12511511 | F032700 | YCGYSLTSPFFFLLSEHKRCDNTATNLNSEDCRNRMVASLWGSLGTGTKEDESSIGRVWAAGLHHVTARSHLACIFKLMNRLFL* |
| Ga0133780_1310491 | Ga0133780_13104911 | F047149 | MHVITYSPNFAPPHFAARGIPKDTPHGTMESHTAYIYMLSVYPFRMELFSFSLYTKHTLLHGLIFFVKYGKV* |
| Ga0133780_1381235 | Ga0133780_13812351 | F006510 | AVTRELNNISKTAFLEGMKKLKERANRCIDQGGMYFEE* |
| Ga0133780_1404397 | Ga0133780_14043971 | F000028 | HFEEKNGECAACLKYSVLIFVEKNIYKMQHLEGSGTPVLYIGRTVLKG* |
| Ga0133780_1441498 | Ga0133780_14414981 | F050459 | MVTGHSNIKSHLHRFKIIDAPTCPCGNDSQTTEHILLECTILHEDRESLTAAVAEEDSWPINKDKLIKRHNKAFAKFTQQLDKIKEMNT* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |