NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009986

3300009986: Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG



Overview

Basic Information
IMG/M Taxon OID3300009986 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114297 | Gp0127580 | Ga0105033
Sample NameSwitchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size38332961
Sequencing Scaffolds7
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSwitchgrass Associated Microbial Communities From Austin, Texas, Usa, To Study Host-Microbe Interactions
TypeHost-Associated
TaxonomyHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Associated Microbial Communities From Austin, Texas, Usa, To Study Host-Microbe Interactions

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant surface

Location Information
LocationUSA: Austin, Texas
CoordinatesLat. (o)30.387Long. (o)-97.7301Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000199Metagenome / Metatranscriptome1639Y
F000492Metagenome / Metatranscriptome1078Y
F007426Metagenome / Metatranscriptome351Y
F026874Metagenome / Metatranscriptome196Y
F032552Metagenome / Metatranscriptome179Y
F061504Metagenome / Metatranscriptome131N
F065178Metagenome128Y
F068797Metagenome / Metatranscriptome124Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0105033_103757All Organisms → cellular organisms → Bacteria1286Open in IMG/M
Ga0105033_105451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1094Open in IMG/M
Ga0105033_112170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae762Open in IMG/M
Ga0105033_117131Not Available652Open in IMG/M
Ga0105033_119033Not Available622Open in IMG/M
Ga0105033_124016Not Available559Open in IMG/M
Ga0105033_126494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0105033_103757Ga0105033_1037573F065178MRRAAYVISAASVLFTLTVHAQEGKRPLIPDRPSYRSDRPSAPTVTEALKALGAITVGDVRSMSDRDLRQLTDLLKQWIDIVGIEERRRNDRPDGKGRIPLSKD*
Ga0105033_105451Ga0105033_1054511F026874MQMLLFTVLGAAVMVIAYAFGVPGPVCGLLFLGGVFTGALLRVAQPIIDWITRP*
Ga0105033_112170Ga0105033_1121701F032552VIVGLAISCSKIGQKPAKMKYLQNICANVKTTNNWAEVRMVSDFDIKFMPLSKLNRG*
Ga0105033_112170Ga0105033_1121702F061504FEEKDRMENPSLNISLLCLAPKYLDLILWALSFGLHWRVDVHEWASNHHGLRSFVRALAFVILRVIA*
Ga0105033_117131Ga0105033_1171311F000492MNVGAKQGELVQLLQKFVPRSHIGIFRNENNQSTPLDPI
Ga0105033_119033Ga0105033_1190332F068797MGQMTPPSSDEPAGISHEEARQELFGRGPSRAGLAAYEIIVIVIAIVGAAIAFEEIDHWSQWVVLGGIIFALIGFMIALSPNREE*
Ga0105033_124016Ga0105033_1240161F000199VHSGPLGCLTKLGAKWAELVQKFVPRSRIGIIRNERARSTPFDPKLMFWCILNHLGAFGTVWFPYETRGKTGRTSAKVRVNKVASEF
Ga0105033_126494Ga0105033_1264941F007426VNMTHVVLSIPAIVIATIVVGIPFNRLLGGTRTALERLVIALVSIPATVVLAVALFTFNALVPDLYAELLRFADWIWQASLNALSAWGDSLPGVRKLANAARQGFSGHHYVIMALCSMLASFIVNALFVSLSASGR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.