 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010053 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121386 | Gp0153999 | Ga0134290 |
| Sample Name | Insect gut microbial communities from Cryptocercus cockroaches from Viginia, USA |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Barcelona |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 144656856 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Odonata → Zygoptera → Coenagrionoidea → Coenagrionidae → Ischnura → Ischnura elegans | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Insect Gut Microbial Communities From Cryptocercus Cockroaches From Viginia, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Intestinal Tract → Insect Gut Microbial Communities From Cryptocercus Cockroaches From Viginia, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Virginia, USA | |||||||
| Coordinates | Lat. (o) | 37.5 | Long. (o) | -79.0 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052004 | Metagenome | 143 | Y |
| F076214 | Metagenome | 118 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134290_1062894 | Not Available | 531 | Open in IMG/M |
| Ga0134290_1067982 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Odonata → Zygoptera → Coenagrionoidea → Coenagrionidae → Ischnura → Ischnura elegans | 688 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134290_1062894 | Ga0134290_10628941 | F052004 | MDVGGEDARWVELAQDRVQWRALVLSMLNLRDLLPES* |
| Ga0134290_1067982 | Ga0134290_10679821 | F076214 | DRLREFLDNYDVAFELVSEDKHDILLKFVKAKITGEARSKLMVRDLTDTWEQVRSILEENYAVKRTLDFYACKMFNAKQGKEEGVANWGSRIDGHQTQLREAARRICKKEEIVGAVALIGHLGKACFVQGLANDRIQTVVRSRGESILLSSAIELALEEESAYFVSQGERRI* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |