 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010260 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120398 | Gp0147151 | Ga0129315 |
| Sample Name | Eastern black-and-white colobus group fecal microbial communities from Wisconsin, USA - Cm827 metagenome |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 144177029 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Oscillibacter → Oscillibacter valericigenes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Eastern Black-And-White Colobus Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.07 | Long. (o) | -89.4 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029444 | Metagenome | 188 | Y |
| F056682 | Metagenome | 137 | Y |
| F068855 | Metagenome | 124 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0129315_1004126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3835 | Open in IMG/M |
| Ga0129315_1007080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2627 | Open in IMG/M |
| Ga0129315_1025642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Oscillibacter → Oscillibacter valericigenes | 987 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0129315_1004126 | Ga0129315_10041266 | F068855 | VPTVEAQGPQVRKSLAPQGLQAEKESENANVRNAGWLHSFDADYHYRGSDLHYHVNVSAALSEEGAAW* |
| Ga0129315_1007080 | Ga0129315_10070805 | F056682 | MKTQSRAGKAATQSIGQGKMYSASFRAFPSKNRITFPIQELEKIHENQEVL* |
| Ga0129315_1025642 | Ga0129315_10256421 | F029444 | MGVSEQLTGFELEDLMSWTVSNLQRPFREDFSLEKSGIIAEKESQISGCRFVGFDGLKKRRPFSISKRVLAAASETAGRR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |