Sample 3300010940

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300010940

3300010940: Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C0

Overview

Basic Information
IMG/M Taxon OID	3300010940 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121583 \| Gp0157198 \| Ga0139172
Sample Name	Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C0
Sequencing Status	Permanent Draft
Sequencing Center	Autonomous University of Barcelona
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	3499041
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain
Type	Engineered
Taxonomy	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Alicante,Spain
Coordinates	Lat. (^o)	38.34	Long. (^o)	-0.48	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082719	Metagenome / Metatranscriptome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0139172_11369	Not Available	671	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0139172_11369	Ga0139172_113692	F082719	MAGRQQDFISNARTVNKQIWDGINALVAMQHEWTALDYGNTLEDGEGGNADYTALEVGAVVFDTANAMVAVLAAGQATNMAKLL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.