Basic Information | |
---|---|
IMG/M Taxon OID | 3300011973 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113963 | Gp0134613 | Ga0119783 |
Sample Name | Human oral microbial communities from Los Angeles, CA, USA - S04-01-D |
Sequencing Status | Permanent Draft |
Sequencing Center | University of California, Los Angeles |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 119263836 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Oral Microbial Communities From Los Angeles, Ca, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Los Angeles | |||||||
Coordinates | Lat. (o) | 34.0722 | Long. (o) | -118.4441 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046431 | Metagenome | 151 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0119783_1058393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | 506 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0119783_1058393 | Ga0119783_10583931 | F046431 | KRISKIGITIILILSIIISYGSVIISMAAESELTLTPKSETNNIHLKWTGPQNSSYKVYQKKPGSSTFETIGLTDFSNNATDEEVKVLNVYPHSKNIGKLWEGSSAFQTLPMVNVTYLDGHTETIEKSALLKVWMEGRNSK* |
⦗Top⦘ |