NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300012327

3300012327: Human skin bacterial and viral communities - University of Pennsylvania - MG100562



Overview

Basic Information
IMG/M Taxon OID3300012327 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118646 | Gp0138212 | Ga0118275
Sample NameHuman skin bacterial and viral communities - University of Pennsylvania - MG100562
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Pennsylvania
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size15251276
Sequencing Scaffolds15
Novel Protein Genes17
Associated Families11

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum5
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Skin Bacterial And Viral Communities - University Of Pennsylvania
TypeHost-Associated
TaxonomyHost-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020492Metagenome223Y
F020828Metagenome / Metatranscriptome221Y
F027342Metagenome195Y
F059631Metagenome133Y
F067310Metagenome / Metatranscriptome125Y
F076912Metagenome117Y
F081962Metagenome113Y
F083289Metagenome113Y
F092835Metagenome / Metatranscriptome107Y
F094706Metagenome105Y
F098130Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0118275_100226Not Available1443Open in IMG/M
Ga0118275_101223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii913Open in IMG/M
Ga0118275_102068All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum770Open in IMG/M
Ga0118275_102098All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu766Open in IMG/M
Ga0118275_102796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum693Open in IMG/M
Ga0118275_102914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum686Open in IMG/M
Ga0118275_103059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum673Open in IMG/M
Ga0118275_103369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu651Open in IMG/M
Ga0118275_103391Not Available649Open in IMG/M
Ga0118275_103676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata631Open in IMG/M
Ga0118275_104003All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum613Open in IMG/M
Ga0118275_104376All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae595Open in IMG/M
Ga0118275_104423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii593Open in IMG/M
Ga0118275_104870All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae571Open in IMG/M
Ga0118275_105814Not Available535Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0118275_100226Ga0118275_1002261F076912LENSTALSNGKGSNADKVQDSETSLLVSKKADKNYLDDSEGTQKSCLDVVFELLATTAGTSSSNSLPESVRLLESQLQVERHRSDVLRQEAEGLRKSLQNSDAYFLVQQQALEDLSAKQEKVNKLAKHLASIMGTQDIVS*
Ga0118275_101223Ga0118275_1012231F092835MNPGVRLRVGHQPSQFWPILARLMDYYSPFWGPEAISTVIEPQGALTCRSSTLAILADSGPFHGLLLTVLGSRSDFHD*
Ga0118275_101223Ga0118275_1012232F092835MNTGVRLCVGHQHSQFWRILAHFLDYYSPFWGPEAISIVIEPEGALMCRSSTLAVLADSGPFHVLLLTVLGFQSDFHD*
Ga0118275_101241Ga0118275_1012411F027342SLERDSKTRESELATALESAKAAKAEAYKALQEIEAVKKIAAGKAFFMQSKHVSVNYLSLTRIRSSPGAFADLLRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKAAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALARAKVHWGKMDAQKLVTDPPPEGKEHRTPEMYYKSVLKGARTIAGECSKDVIFE*
Ga0118275_102068Ga0118275_1020682F020828MSDQLKQLVELHKAAEQAMKGFIVRMWPGDALPNSYFGLVRRLVDACPRLEVIKRSVCIEGARRAFARVKVQWAKLDAVKLIKEGPPQGKEHRTPEIYYEGVLKGARLVADECSKDVIFE
Ga0118275_102098Ga0118275_1020981F059631QAECGGAMVGKMANVLWLEGSFVETLKGWQSGWFYITERRDPEWVTAPEFRSGPPTRLTSWKETGLSWGSKGEVTGLQTCIQTLVDKQLKLVNIVQVMLIRLILPCQQWAFNLWEFDPARHQTLSRLFDTTYEDAWKVLFKGAEAPASATEDRGFSTQRHACAVSYFYLL*
Ga0118275_102796Ga0118275_1027961F083289EEGDTAYAESVCATEELKFYKDNVDPTDMTSLKKPTTEHEPAMKFKSADETKLVDFVPGDSSQQFSISANLDPK*
Ga0118275_102914Ga0118275_1029142F020492MQASLLAFAILTAEVDTLKQNLEQSEQELGRAKKQLEEKEGKKYLV*
Ga0118275_103059Ga0118275_1030591F081962KTGPRSANLNQNVLTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLADVLRRLAVLPQRFQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFAACVKSVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEAVSLIPPTRKHTFAPEVDPAGLIDDEAQFEALSGIDWKSSTFQVMESAGGAERDEPGASTQQAP*
Ga0118275_103369Ga0118275_1033691F059631FYITEPRDPKWAAAPEFRYGTPMQLTSWKGKGLLWGSSEELTGLQSCLQTLVNKKLKLVNVIQVMLVRRILPCQQRAFNLWEFDPAQHRTLSGLFDTTYEAAWRVLFKGAEAPASATEDRGFSTQRPAGEVSYVILYGTLISFIV*
Ga0118275_103391Ga0118275_1033911F092835VRLRIGHQHSQFWPILARFVDYYSLFCGPGVISTINEPWGAFTIWSSTLAGLVDSDAFHGLLLTVLGTQTGFVVVEPQGAFT
Ga0118275_103676Ga0118275_1036761F098130MPGPHPRRRPVRDDVQPTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRREPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQFLQGSHFSYDPVRVPSLWVSTARAAGTASVLDSSIVFDL*
Ga0118275_104003Ga0118275_1040031F081962VVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGSAFDQKDFAACVKAVRPVATLIGNDTDLTKYQPGYDVENQRIPTPRYEAISLVPPTRKHTFAPEIDPAGLIDEEAQFEALSGIDWKSSTFQVLGTAGGAERDEPEASTQQAS
Ga0118275_104376Ga0118275_1043761F094706LKGSFEGLKGYAVGRMTKSRRGKLYIDDANWGPDAGSIEYGYRVPFGGIHVFIGKIGEPGPEPDLCADLIETAQRARPARALPALTHAFLGCIHGGLSDRSGSGDETAAGSDGESATDESNSLYQLQDGRLMGCSDGDSIPDPFEPPSWVGIFMAGAQPVQNPAAG
Ga0118275_104423Ga0118275_1044231F092835VRLRVGHQHLQFWPILDRFVDYYSLFWGPGVVSMIDEPLGVLTCRSSTLVVSPDSGPFRGLLLTVLGSRSESHD*
Ga0118275_104870Ga0118275_1048701F067310CGADVALSLVRVHCKEAREDKVAAIKVANTKRHDFQSFMETFIAAATRIADGIDLDEFVEPASPPPAE*
Ga0118275_105814Ga0118275_1058141F092835VRLRAGHQHSRFWSILTRFVHYYSPFWRPEVISMLVEPQGVFTCRSSTLTVLADSGPFHGLLLTVLES
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.