NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300012606

3300012606: Human skin bacterial and viral communities - University of Pennsylvania - MG100507



Overview

Basic Information
IMG/M Taxon OID3300012606 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118646 | Gp0138157 | Ga0118220
Sample NameHuman skin bacterial and viral communities - University of Pennsylvania - MG100507
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Pennsylvania
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size19912186
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum3
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Skin Bacterial And Viral Communities - University Of Pennsylvania
TypeHost-Associated
TaxonomyHost-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011735Metagenome / Metatranscriptome287Y
F020492Metagenome223Y
F020828Metagenome / Metatranscriptome221Y
F034384Metagenome175Y
F076912Metagenome117Y
F105149Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0118220_101083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1202Open in IMG/M
Ga0118220_103471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum734Open in IMG/M
Ga0118220_105842All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum580Open in IMG/M
Ga0118220_107503Not Available520Open in IMG/M
Ga0118220_107636All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis516Open in IMG/M
Ga0118220_107675All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum515Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0118220_101083Ga0118220_1010832F034384VIVLAEFCQNFEEETSRLEPNLDPVNSPVNDEVAMNVFRLESRVAAVVDYLAKLKAATSRIDSTLWPEETLQNDLESLMARLNTIPGRVQEWKKFSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG*
Ga0118220_103471Ga0118220_1034711F076912LGKSALLSNDKGSNADKVQDSDTSCLGLVLELLATTACTSYSNSLSESVRFLESQLQAERHRSAVLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANKLAKLIASMVDTQDNIS*
Ga0118220_105842Ga0118220_1058421F020492TAEVDTLKQNLEQSEQELGRAKKQLEDKEGKKYLV*
Ga0118220_107503Ga0118220_1075031F011735PYIVKRKLAKGAYELIDFDGVPLDKPRNGLYLKRYYA*
Ga0118220_107636Ga0118220_1076361F105149MHFYFEVTKISEISRKRNMLRRMYQGGSSAKNGPRIAIREQDVELPRDVDVRACEWPSDDFMVEAGFKEEFDAYVRNAELEDFLQDKCPQYYQLTDSFVRRFEYISLRNSPSVMFDIYDTSYTMDLEDFTTACKLPQWGNINDPRKSEFRDFLASITVGESRD
Ga0118220_107675Ga0118220_1076751F020828SVSDAAAFYQAEEGRSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKVAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALARAKVHWGKMDAQKLVTDPPPEGKEHHTPEMYYKSVLKGALTIAGECSKDVIFE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.