NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300012627

3300012627: Human skin bacterial and viral communities - University of Pennsylvania - MG100570



Overview

Basic Information
IMG/M Taxon OID3300012627 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118646 | Gp0138220 | Ga0118283
Sample NameHuman skin bacterial and viral communities - University of Pennsylvania - MG100570
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Pennsylvania
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size22882855
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Skin Bacterial And Viral Communities - University Of Pennsylvania
TypeHost-Associated
TaxonomyHost-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081456Metagenome114N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0118283_106257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes694Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0118283_106257Ga0118283_1062572F081456MFEEPPIYYILISLIFLIVFGAISFATWLVWLTNGAFFFKLVITAIGFLFAAFTVILYTISAE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.