 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300012978 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0126268 | Gp0177339 | Ga0157393 |
| Sample Name | Hot spring water viral communities from Western Cape, South Africa - Brandvlei |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of the Western Cape |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 11115694 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hot Spring Water Viral Communities From Western Cape, South Africa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hot Spring Water → Hot Spring Water Viral Communities From Western Cape, South Africa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hot spring → spring water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Western Cape, South Africa | |||||||
| Coordinates | Lat. (o) | -33.732496 | Long. (o) | 19.413317 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042051 | Metagenome / Metatranscriptome | 159 | Y |
| F076964 | Metagenome | 117 | Y |
| F093488 | Metagenome / Metatranscriptome | 106 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0157393_12862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2033 | Open in IMG/M |
| Ga0157393_16101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| Ga0157393_16672 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0157393_12862 | Ga0157393_128622 | F093488 | MADGLFYWDTREPFIGADIASVTLSTTDVALYPPSNFPVLGGQYWSRVGKKIRIRLFGRMTTGATPGNLTFDIYYGSGANATGTILASSAAVALTASQTNLSWMCEVTVHCRSIGSSGTLFCVGWALFNPSLIASTNQPILIPASAPVVSAAVDLTAANIISIQAKRSGSTTETMQVHDMEVVAMN* |
| Ga0157393_16101 | Ga0157393_161012 | F042051 | MVTFGEISWDDDVFGDESKKNNSKDLFLRLDEGSNEMRIITQPHQYLVHRYKKEGDPGFGHRVYCSMAHGFCPLCAMGDKAKPRWLLGVISRKTGTYKILDISFAVFSQIRKLARNTQRWGDPTKYDIDIVVDKNGGATGYYSVQPVSK |
| Ga0157393_16672 | Ga0157393_166722 | F076964 | MSDYKVWLRPPWGVGEPKEVDATPDVLVPLLVAGWAQCEPPAPKEEVKEDVHG* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |