NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013050

3300013050: Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C BE-Lig MG (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300013050 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0127392 | Gp0191750 | Ga0164269
Sample NameEnriched Miracle-Growth compost microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C BE-Lig MG (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size34432248
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → anthropogenic environment → compost
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003009Metagenome / Metatranscriptome513Y
F071833Metagenome / Metatranscriptome121Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0164269_114897Not Available713Open in IMG/M
Ga0164269_125161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea7406Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0164269_114897Ga0164269_1148971F071833NILNYLLTMNFVNDSTQDPQQRINFAQVLIKRKLIEPFEKLSRENVECYNLEKGAKEGNGQYIERVNKCLDSWQRHFERVEEKTNKYLISLREKEAHHFSKLFHCTNAINEPEVQACRIEENERFANELKETFSQL*
Ga0164269_125161Ga0164269_1251614F003009LVWFQRPYFNTNILNLVKYFATLTVSFHDIHSLFGFFILLVVVSQLVSGTMLSFSLVPEAMMVPLVRDEEDIEDLYTDDFF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.