NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013391

3300013391: Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR13_S1_MetaG



Overview

Basic Information
IMG/M Taxon OID3300013391 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0127568 | Gp0198144 | Ga0180014
Sample NameGroundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR13_S1_MetaG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size89845296
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGroundwater Microbial Communities From Three Deep Subsurface Sites In Europe
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biome → planetary subsurface zone → groundwater
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationFinland: the Olkiluoto Island
CoordinatesLat. (o)61.2418Long. (o)21.4803Alt. (m)N/ADepth (m)410
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034814Metagenome173Y
F061521Metagenome / Metatranscriptome131Y
F074388Metagenome119N
F076223Metagenome / Metatranscriptome118Y
F096722Metagenome104Y
F098715Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0180014_1000616All Organisms → cellular organisms → Bacteria9355Open in IMG/M
Ga0180014_1003773Not Available2310Open in IMG/M
Ga0180014_1011968All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans1040Open in IMG/M
Ga0180014_1018020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium821Open in IMG/M
Ga0180014_1018511All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans808Open in IMG/M
Ga0180014_1021691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium740Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0180014_1000616Ga0180014_10006166F096722MNDEKETYVGPVEQEINSMMGTTGNEIMDITQKGAGTKEDETVQNIHIVNLSRCIIYLAKEIDKLAKPIR*
Ga0180014_1003773Ga0180014_10037732F061521MNEAQIRIEVERIVNLVAGFGWSKVEEKISAGEIRLTLLKVLPEEKATAA*
Ga0180014_1011968Ga0180014_10119682F098715MADSIKVQAMQKLAGVFGAVASIGSVHRWQGSPTDLDRVKLPALFFWDEEETRDKRNRLAMGTLKLYVAVFIRLSPAGAASFNDVADNLQGTIHNALLGTSELQGLVENLQEERVWKEFPNDQYGVLFMSFTLTYAHAWGDAFSTTY*
Ga0180014_1018020Ga0180014_10180203F074388GETKNLWRWSMKVAEKKKVNKAVGVVVDPTYFSEIPLADIMDAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSQETGKLDNSNLRLSWYTMASGRYEVLAYVA*
Ga0180014_1018511Ga0180014_10185111F076223MGCRQSGAMLMAGLAVLFMVIMAAAPAPLQAANQVAELMVSDHADAKGVVEQHQSKFSSSVAEIYGTALISGAKKGKEVTTELFYVTQNLNVLSSRDDLPDDGEVTLTFAFPKPDKGWPAGDYKLVISIAGGATKAVTFQVK*
Ga0180014_1021691Ga0180014_10216911F034814MTSLAAEKIETLPGLHSCFTCADNMGCNLEMRCESMAGCLKWRCRVCRAPWWAVGYHHESCNATGVPNGVTYHDGTHMAPLPEASGHYYRHGGYCRVHQSWRCGLGRPDADQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.