Sample 3300013459

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300013459

3300013459: Lung microbial and viral communities from cystic fibrosis patients in San Diego, USA - CF1-2A-St-MgMD-nonhuman

Overview

Basic Information
IMG/M Taxon OID	3300013459 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118644 \| Gp0137864 \| Ga0117825
Sample Name	Lung microbial and viral communities from cystic fibrosis patients in San Diego, USA - CF1-2A-St-MgMD-nonhuman
Sequencing Status	Permanent Draft
Sequencing Center	San Diego State University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	7583924
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Lung Microbial And Viral Communities From Cystic Fibrosis Patients In San Diego, Usa
Type	Host-Associated
Taxonomy	Host-Associated → Human → Respiratory System → Sputum → Unclassified → Human Lung → Lung Microbial And Viral Communities From Cystic Fibrosis Patients In San Diego, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal corpus

Location Information
Location	USA: San Diego
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026592	Metagenome / Metatranscriptome	197	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0117825_16403	Not Available	539	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0117825_16403	Ga0117825_164032	F026592	GLIFSIRFFKLAGGEQHLCCLRTASPQGIAALASQGSVAPLTEQSDATFSVGQFSSADRE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.