Sample 3300013731

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300013731

3300013731: Human skin bacterial and viral communities - University of Pennsylvania - MG100610

Overview

Basic Information
IMG/M Taxon OID	3300013731 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118646 \| Gp0138260 \| Ga0118326
Sample Name	Human skin bacterial and viral communities - University of Pennsylvania - MG100610
Sequencing Status	Permanent Draft
Sequencing Center	University of Pennsylvania
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	17886341
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Skin Bacterial And Viral Communities - University Of Pennsylvania
Type	Host-Associated
Taxonomy	Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal surface

Location Information
Location
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067847	Metagenome	125	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0118326_102785	All Organisms → Viruses → Predicted Viral	1058	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0118326_102785	Ga0118326_1027851	F067847	MFSHIIRVKGIFDDEPTTKKLYFHMSRREMFDFIKRYDNVTNFEKWLQAAIDNEDLYTMMKFFDDLIGTSYGERQGERFVKSEQIKESFLNSPEYEELFDQLMDNPALVREFYNGILPEKIMKQVQQDPKYKELDDKLKETELNNL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.