 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013745 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118456 | Gp0134834 | Ga0116841 |
| Sample Name | Oral microbial communities from fossilized dental plaque from Dalheim, Germany - S5-Shot-G12-calc |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Oklahoma |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 55608129 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 2 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Oral Microbial Communities From Fossilized Dental Plaque From Dalheim, Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Fossilized Dental Plaque → Oral Microbial Communities From Fossilized Dental Plaque From Dalheim, Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany: Dalheim | |||||||
| Coordinates | Lat. (o) | 51.565093 | Long. (o) | 8.849015 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054111 | Metagenome | 140 | N |
| F066860 | Metagenome | 126 | N |
| F095630 | Metagenome | 105 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0116841_1009132 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 793 | Open in IMG/M |
| Ga0116841_1009494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 781 | Open in IMG/M |
| Ga0116841_1022012 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 552 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0116841_1009132 | Ga0116841_10091321 | F095630 | LQSRGFFISSDIILTAKTYGDTCFIDAELYNPAAQKAYGEALRLFDEWDIPGGVALRAAGECGIEVNRAVVELQQDELLHNLNTVQSSVWCRQSDMTYCKADDKSSVNTLFRVPYVKYGRKSKNIFPEYVLEYSVDEKYIQSPVDQSLAAVVMQVAALNFLVMIREKHTVYDRGDQWSEASKSVGYRMFLGLIKKDDSIVHQLKCEFMEYVQFLSASSFCDNLQEALVRCSHNYEQVLLGRDTLNSILGGCVIGGQGGLKVADN |
| Ga0116841_1009494 | Ga0116841_10094941 | F066860 | MTTKKQKLQKQQTIDTWIIIALWASAIWFSLARGFITGIGGWVLALLGPWALIVSCICLAIISRQVKKRHASKDHLTTIVRVSFIVMSISLFICGLAMPDFSDIETFSTLSVYTNNAISFETSKAIAIISGFVVVLSLFVAVTFGIAEDREETTEDVAI* |
| Ga0116841_1022012 | Ga0116841_10220122 | F054111 | MNKSLESITHEEFLKLMERLKNLQELTFLEYIMAPEADIFYFNFMEKTVKIKWDLDYGLFLETESLSTADRDLFLNIFLIKRFSFGRRNYNIPT* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |