Sample 3300013971

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300013971

3300013971: Human oral microbial communities from various locations - University of British Columbia - SCG24

Overview

Basic Information
IMG/M Taxon OID	3300013971 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118603 \| Gp0137812 \| Ga0120323
Sample Name	Human oral microbial communities from various locations - University of British Columbia - SCG24
Sequencing Status	Permanent Draft
Sequencing Center	University of British Columbia
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	1060009
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal secretion

Location Information
Location
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051214	Metagenome	144	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0120323_10496	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	681	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0120323_10496	Ga0120323_104961	F051214	MPGKIVAHDTHLRIDTEFIELKDCFEAFRRGVEYREKNDVDDILVICNAPDIIEYQLKNGDSFIVTYDPIHRIIVIRVFLHDEDITIKPIYIYNNREYQIACEFPR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.